KEGG   Sorghum bicolor (sorghum): SORBI_09g023850Help
Entry
SORBI_09g023850   CDS       T01086                                 

Gene name
SORBIDRAFT_09g023850, Sb09g023850
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbi00520]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 279 aa AA seqDB search
MEFLHGQRLETTVAIAVAVVAVAAGAAYLFLRSRKTRGCLDPENFKEFKLVEKRQLSHNV
AKFKFALPTPTSALGLPIGQHISCRGQDAAGEEVIKPYTPTTLDSDLGSFELVIKMYPQG
RMSHHFREMKVGDYMSVKGPKGRFKYLPGQVRAFGMIAGGSGITPMFQVTRAILENPKDN
TKVHLIYANVTYDDILLKEELDSMAKNYPDRFKIYYVLNQPPEVWDGGVGFVSKEMIQTH
CPVPAADIQVLRCGPPPMNKAMAAHLDDLGYTKEMQFQF
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctgcacgggcagaggctggagaccacggtggccatcgcggtggccgtcgtc
gccgtcgccgcgggggccgcctacctcttcctccgcagcaggaagaccaggggctgcctg
gaccccgagaacttcaaggagtttaaacttgttgagaagaggcaactgagtcataatgtt
gccaagttcaagtttgcactcccgacacctacttctgcattgggtcttccaatcggacaa
catataagctgcagaggacaggatgctgctggtgaggaagtgatcaagccttatactcca
actactctggactctgatcttggatcctttgagcttgttataaagatgtatccccaagga
agaatgtctcatcatttccgtgagatgaaagttggtgattatatgtctgtgaagggacct
aagggtcgtttcaagtacctacctggacaagtgagagcatttggaatgatagctggagga
tcaggcattactccaatgttccaagtcacaagggcaattcttgagaacccaaaagacaat
acgaaagtacacttaatctatgcaaatgtcacatatgatgatattcttctgaaggaagaa
cttgacagtatggccaaaaactatcccgatcgcttcaagatctactatgtcttgaatcag
cctcccgaagtctgggacggtggtgtcgggttcgtctcaaaggaaatgatccaaactcat
tgtccagtgcccgctgccgacattcaggtattgcgatgtggccctcctcccatgaacaaa
gccatggctgcacacctggacgatctcggttacacgaaggagatgcagttccagttctaa

DBGET integrated database retrieval system