KEGG   Sorghum bicolor (sorghum): SORBI_09g026120Help
Entry
SORBI_09g026120   CDS       T01086                                 

Gene name
SORBIDRAFT_09g026120, Sb09g026120
Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 131 aa AA seqDB search
MSWQTYVDEHLMCEIEGHHLTSAAIAGHDGAVWAQSATFPEFKPEDMTNIMKDFDEPGHL
APTGLFLGATKYMVIQGEPGAVIRGKKGSGGITVKKTGQALIIGIYDEPMTPGQCNMVVE
RLGDYLVEQGM
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggcagacgtacgtggacgagcacctgatgtgcgagatcgagggccaccacctc
acgtcggcggccatcgccggccacgacggcgccgtctgggctcagagcgccacattcccc
gagttcaagcccgaggacatgaccaacatcatgaaggatttcgatgagccggggcacctc
gcgccgacaggcctgtttcttggagccacgaagtacatggtcatccaaggtgaacccggc
gctgtcattcgtggcaagaagggatcaggaggcatcactgtgaagaagacagggcaggca
ctcatcattggcatctacgacgagccgatgactcccgggcagtgcaacatggtggtggaa
aggctgggcgactacctggttgaacagggcatgtag

DBGET integrated database retrieval system