KEGG   Sorghum bicolor (sorghum): SORBI_09g026450Help
Entry
SORBI_09g026450   CDS       T01086                                 

Gene name
SORBIDRAFT_09g026450, Sb09g026450
Definition
hypothetical protein
Orthology
K07198  
5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Regulation of autophagy
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Cellular Processes
  Transport and catabolism
   04140 Regulation of autophagy
    SORBI_09g026450 (SORBIDRAFT_09g026450)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     SORBI_09g026450 (SORBIDRAFT_09g026450)
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: CAMK group
  CAMKL family
   SORBI_09g026450 (SORBIDRAFT_09g026450)
Mitochondrial biogenesis [BR:sbi03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    SORBI_09g026450 (SORBIDRAFT_09g026450)
  Mitophagy factors
   Other mitophagy factors
    SORBI_09g026450 (SORBIDRAFT_09g026450)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 504 aa AA seqDB search
MMEGTGRDANPLSGYRIGKTLGIGSFGKVKIAEHILTGHKVAIKILNRRKIRSMEMEEKV
KREIKILRLFMHPHIIRLYEVIDTPADIYVVMEYVKSGELFDYIVEKGRLHEEEARRFFQ
QIISGVEYCHRNMVVHRDLKPENLLLDSKCNVKIADFGLSNVMRDGHFLKTSCGSPNYAA
PEVISGKLYAGPEVDVWSCGVILYALLCGTLPFDDENIPNLFKKIKGGIYTLPSHLSPSA
RDLIPRMLVVDPMKRITIREIREHVWFKIRLPRYLAVPPPDTAQQVKKLDEETLNDVIKM
GFDKNQLIESVQNRLQNEATVAYYLLFDNRLRTTSGYLGSEFQESMDSSFSQVIAETPTS
ATELRQHGFTESPGSGLRQHFAAERKWALGLQSRAHPREIISEVLKALQELNVYWKKIGH
YNMKCRWSPGCLESMMHSSDGFSAESAIIETDDLMAKSTPIVKFEIQLYKTRDEKYLLDL
QRVSGPQLLFLDLCSAFLTQLRVL
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgatggaggggactggaagagatgccaacccattgagcggttaccgaattggcaaaacc
ctgggaattgggtcgttcggtaaagtgaagatcgcggaacatatattgactggccataag
gtggcaatcaagatcctcaatcgcaggaagatcagaagcatggaaatggaagagaaagtg
aagagagaaatcaagatactgagattatttatgcatcctcatatcatacgcctttatgag
gtgatagatacacctgctgatatttatgttgtcatggagtatgttaaatctggagagttg
tttgattacatcgttgagaagggaagactacacgaagaagaagcccgtcgcttttttcag
cagatcatatctggtgttgaatattgccataggaacatggttgttcaccgtgatttaaag
ccagagaatcttcttttggattcaaaatgcaatgttaagattgctgattttggcttaagt
aatgttatgcgtgatggtcactttcttaagacgagttgtggtagcccgaattatgcagca
cccgaggtcatatctggtaaactatatgctggtcctgaagttgatgtctggagctgtggc
gttattctttatgctcttctttgtggtactctcccttttgatgatgagaatattccaaac
cttttcaagaaaataaagggtggaatatatacccttcctagtcacttgtcaccttcagcg
agggacttgattcccagaatgctggttgttgatccgatgaaaaggattacaatacgtgaa
atccgtgaacatgtgtggttcaagattcgacttccacgctatttggctgtgccgcctcca
gatactgctcaacaagttaaaaagctcgatgaggaaactcttaatgatgttatcaagatg
ggttttgacaagaatcagctaattgaatctgtgcaaaacagattgcagaatgaggcaaca
gttgcctattatttactcttcgacaataggcttcgtacaaccagtggttatcttggatct
gagtttcaagaatctatggactcatctttctctcaagtaatcgctgaaacaccaacttca
gcaactgaacttcggcagcatgggtttacagaatctccggggtctggcttgaggcagcat
tttgcagctgaaaggaaatgggcccttggtcttcagtctcgagcacatccacgagaaata
atcagtgaagtgcttaaagctctgcaagaactgaatgtttactggaagaagattggacac
tacaacatgaaatgcagatggagtcctggctgcctggagagtatgatgcatagcagtgat
ggctttagtgcggagtctgctataattgaaactgatgatctcatggcgaaatcaacccct
atagtgaagtttgagattcagctttacaagacgagggatgagaagtaccttcttgacctg
caaagggtcagtggaccacagctcctctttctggacttgtgttccgcctttctaactcag
ctgagagttctttga

DBGET integrated database retrieval system