KEGG   Sorghum bicolor (sorghum): SORBI_09g026870Help
Entry
SORBI_09g026870   CDS       T01086                                 

Gene name
SORBIDRAFT_09g026870, Sb09g026870
Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SORBI_09g026870 (SORBIDRAFT_09g026870)
  Lipid metabolism
   00600 Sphingolipid metabolism
    SORBI_09g026870 (SORBIDRAFT_09g026870)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    SORBI_09g026870 (SORBIDRAFT_09g026870)
   00604 Glycosphingolipid biosynthesis - ganglio series
    SORBI_09g026870 (SORBIDRAFT_09g026870)
   00511 Other glycan degradation
    SORBI_09g026870 (SORBIDRAFT_09g026870)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SORBI_09g026870 (SORBIDRAFT_09g026870)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SORBI_09g026870 (SORBIDRAFT_09g026870)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 608 aa AA seqDB search
MASGGTFRNLLLVLPLCLALASLVGGEASRRFWIENDTFRKDGAPFQIVGGDVHYFRIVP
EYWKDRLLRAKALGLNTIQTYVPWNLHEPEQQSWKFEGFADIESYLRLAQELEMLVMLRI
GPYICGEWDLGGFPPWLLTIEPALKLRSSDSSYLSLVERWWGVLLPKVAPLLYNNGGSVI
MVQIENEFGSFGDDKNYLHYLVQLARRYLGNNIILYTTDGGAMGNLKNGSIPQDDVFAAV
DFETGSNPWPIFRLQKKYNLPGKSAPLSSLGLLILFLHEVVQMAHGGTNFGFYNGANTGQ
DESDYKPDLTSYDYATLRRVIHECTGTPLHPLPSDIEKASYGLVKLEKVASLFDIIDNIS
DPLKVSVSEHPLYMEQIGQVHDRAQVFVSCSVDGVRNLRYGGVIERWSNKTLEIPNLRCS
STTSLYILVENMGRVNYGPYIFDRKGILSPIQIDGITIRHWKMYPLALNSLDRLPKLQLI
TQIPYVGASKMSIHGDSEKNLQESSSYSNGSISALPAFYEGHFHIDYESEIKDTFISFRG
WNKGVAFVNNFNIGRFWPVRGPQCALYVPAPILRSGDNIVVIFELHDPNPELTIDFVTEP
DFTCGPKQ
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtggaaccttcaggaaccttctcctggtgctccccctctgcctcgcgctc
gcctccttggttggtggcgaggcgtcgaggaggttctggatcgagaacgatacctttagg
aaggatggggcaccgttccagatcgtcggcggcgacgtccactatttccgcattgttcct
gagtactggaaggatcgccttttaagagcaaaagcattaggcttgaacacaattcaaaca
tatgtaccttggaatttgcatgagccagaacagcagagctggaaattcgagggctttgcg
gatattgagtcatatctgagacttgctcaagaactagaaatgttggtcatgcttcggata
ggtccatacatttgtggagaatgggatctaggaggttttccaccttggttgctcaccata
gaaccagcccttaaactgcgatcatcagattcgtcctatctttccttggtggagagatgg
tggggagtactacttccgaaagtggcaccattattatacaataatgggggttcagttatt
atggttcagattgaaaatgaatttggttcttttggggacgataagaattaccttcattac
cttgttcagctggccagaagatatcttggaaacaacattattctttatacaactgatggg
ggcgccatgggtaatttaaagaatggatcaattcctcaagatgatgttttcgctgctgtt
gattttgaaactggatccaatccatggcccatattcaggttgcagaagaaatacaacttg
ccaggaaagtcagcccctttaagttctctaggtctattaattttatttcttcatgaggtt
gtccagatggctcatggtgggaccaattttggattttataatggtgcaaatactggtcaa
gatgaatctgactacaagccagacctcacttcttatgactatgcaacactgagaagagta
atacatgaatgtactgggactcctcttcatccacttccttctgacattgaaaaagcaagt
tacgggcttgtgaaattagaaaaggttgcttctctgtttgatatcattgataatatcagt
gatcctctgaaagtttctgtttcggagcatccactttatatggaacagataggccaggta
catgacagagctcaggtgtttgtgtcttgctcagttgatggtgtcagaaacctaagatat
ggtggtgtaattgaaagatggtctaataaaacactagagataccgaacttaagatgttca
tctactaccagcctatatatcctggtagaaaatatgggtcgtgtaaattatgggccatat
atttttgaccggaagggaatactatctcctattcaaatagatggcattactatccgtcac
tggaaaatgtatccacttgcactcaattcactggacaggcttccaaaacttcaactaatc
actcaaataccttatgttggagccagtaaaatgtccattcatggagactcagaaaagaat
ttgcaggaatcgtcatcctattcaaatggaagcatttctgcactacctgcgttttatgaa
ggacatttccatattgactatgagagtgagataaaggatacattcatatcatttcgtggt
tggaacaagggtgttgcttttgtgaacaacttcaacatcggaagattttggccggtccgc
ggaccacaatgtgccctttatgttccagcgcctatcctcagatctggggacaacattgtt
gtaatctttgaactgcatgatccaaatcctgagctcactatcgattttgttacggaaccg
gatttcacgtgcggtccgaaacagtaa

DBGET integrated database retrieval system