KEGG   Sorghum bicolor (sorghum): SORBI_09g026870Help
Entry
SORBI_09g026870   CDS       T01086                                 

Gene name
SORBIDRAFT_09g026870, Sb09g026870
Definition
hypothetical protein
Orthology
K12309  
beta-galactosidase [EC:3.2.1.23]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Galactose metabolism
Other glycan degradation
Glycosaminoglycan degradation
Sphingolipid metabolism
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbi00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sbi00600]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:sbi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:sbi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sbi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 608 aa AA seqDB search
MASGGTFRNLLLVLPLCLALASLVGGEASRRFWIENDTFRKDGAPFQIVGGDVHYFRIVP
EYWKDRLLRAKALGLNTIQTYVPWNLHEPEQQSWKFEGFADIESYLRLAQELEMLVMLRI
GPYICGEWDLGGFPPWLLTIEPALKLRSSDSSYLSLVERWWGVLLPKVAPLLYNNGGSVI
MVQIENEFGSFGDDKNYLHYLVQLARRYLGNNIILYTTDGGAMGNLKNGSIPQDDVFAAV
DFETGSNPWPIFRLQKKYNLPGKSAPLSSLGLLILFLHEVVQMAHGGTNFGFYNGANTGQ
DESDYKPDLTSYDYATLRRVIHECTGTPLHPLPSDIEKASYGLVKLEKVASLFDIIDNIS
DPLKVSVSEHPLYMEQIGQVHDRAQVFVSCSVDGVRNLRYGGVIERWSNKTLEIPNLRCS
STTSLYILVENMGRVNYGPYIFDRKGILSPIQIDGITIRHWKMYPLALNSLDRLPKLQLI
TQIPYVGASKMSIHGDSEKNLQESSSYSNGSISALPAFYEGHFHIDYESEIKDTFISFRG
WNKGVAFVNNFNIGRFWPVRGPQCALYVPAPILRSGDNIVVIFELHDPNPELTIDFVTEP
DFTCGPKQ
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atggcctccggtggaaccttcaggaaccttctcctggtgctccccctctgcctcgcgctc
gcctccttggttggtggcgaggcgtcgaggaggttctggatcgagaacgatacctttagg
aaggatggggcaccgttccagatcgtcggcggcgacgtccactatttccgcattgttcct
gagtactggaaggatcgccttttaagagcaaaagcattaggcttgaacacaattcaaaca
tatgtaccttggaatttgcatgagccagaacagcagagctggaaattcgagggctttgcg
gatattgagtcatatctgagacttgctcaagaactagaaatgttggtcatgcttcggata
ggtccatacatttgtggagaatgggatctaggaggttttccaccttggttgctcaccata
gaaccagcccttaaactgcgatcatcagattcgtcctatctttccttggtggagagatgg
tggggagtactacttccgaaagtggcaccattattatacaataatgggggttcagttatt
atggttcagattgaaaatgaatttggttcttttggggacgataagaattaccttcattac
cttgttcagctggccagaagatatcttggaaacaacattattctttatacaactgatggg
ggcgccatgggtaatttaaagaatggatcaattcctcaagatgatgttttcgctgctgtt
gattttgaaactggatccaatccatggcccatattcaggttgcagaagaaatacaacttg
ccaggaaagtcagcccctttaagttctctaggtctattaattttatttcttcatgaggtt
gtccagatggctcatggtgggaccaattttggattttataatggtgcaaatactggtcaa
gatgaatctgactacaagccagacctcacttcttatgactatgcaacactgagaagagta
atacatgaatgtactgggactcctcttcatccacttccttctgacattgaaaaagcaagt
tacgggcttgtgaaattagaaaaggttgcttctctgtttgatatcattgataatatcagt
gatcctctgaaagtttctgtttcggagcatccactttatatggaacagataggccaggta
catgacagagctcaggtgtttgtgtcttgctcagttgatggtgtcagaaacctaagatat
ggtggtgtaattgaaagatggtctaataaaacactagagataccgaacttaagatgttca
tctactaccagcctatatatcctggtagaaaatatgggtcgtgtaaattatgggccatat
atttttgaccggaagggaatactatctcctattcaaatagatggcattactatccgtcac
tggaaaatgtatccacttgcactcaattcactggacaggcttccaaaacttcaactaatc
actcaaataccttatgttggagccagtaaaatgtccattcatggagactcagaaaagaat
ttgcaggaatcgtcatcctattcaaatggaagcatttctgcactacctgcgttttatgaa
ggacatttccatattgactatgagagtgagataaaggatacattcatatcatttcgtggt
tggaacaagggtgttgcttttgtgaacaacttcaacatcggaagattttggccggtccgc
ggaccacaatgtgccctttatgttccagcgcctatcctcagatctggggacaacattgtt
gtaatctttgaactgcatgatccaaatcctgagctcactatcgattttgttacggaaccg
gatttcacgtgcggtccgaaacagtaa

DBGET integrated database retrieval system