KEGG   Sorghum bicolor (sorghum): SORBI_09g027430Help
Entry
SORBI_09g027430   CDS       T01086                                 

Gene name
SORBIDRAFT_09g027430, Sb09g027430
Definition
hypothetical protein
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SORBI_09g027430 (SORBIDRAFT_09g027430)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SORBI_09g027430 (SORBIDRAFT_09g027430)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SORBI_09g027430 (SORBIDRAFT_09g027430)
Enzymes [BR:sbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SORBI_09g027430 (SORBIDRAFT_09g027430)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 526 aa AA seqDB search
MAATTHAASMSFLLSHPQSRSATPSRHLQLRPAARRVRCCATDATAAAPAATTKHRRAAD
ENIREEAARHPAPKQGLSAWYEPFPPAPNGDPNERYSLDEIVYRSSSGGLLDVRHDMEAL
ARFSGAYWRDLFDSRVGRTTWPYGSGVWSKKEFVLPEIDPDHIVSLFEGNSNLFWAERLG
RDHLGGMNDLWVKHCGISHTGSFKDLGMTVLVSQVNRLRRAPLSRPIAGVGCASTGDTSA
ALSAYCAAAGIPAIVFLPANRISLEQLIQPIANGATVLSLDTDFDGCMRLIREVTAELPI
YLANSLNSLRLEGQKTAAIEILQQFDWEVPDWVIVPGGNLGNIYAFYKGFEMCRVLGLVD
RVPRLVCAQAANANPLYGYYKSGWTEFQPQVARPTFASAIQIGDPVSVDRAVVALKATNG
IVEEATEEELMNAMSLADRTGMFACPHTGVALAALFKLRDQRIIGPNDRTVVVSTAHGLK
FSQSKIDYHDSKIEDMACKYSNPPVSVKADFGAVMDVLKKRLKGKL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacgacccacgccgcctccatgtcgttcctcctctcccacccgcagtcgcgc
tccgccacgccaagccgccacctccagctccgcccggcagcccgccgcgtccgctgctgc
gccaccgacgccaccgccgccgcccccgcagccaccaccaagcaccggcgcgcggcggat
gagaacatccgcgaggaggcggcgcggcacccggccccgaagcagggcctctccgcgtgg
tacgagcccttcccgccggccccgaacggcgaccccaacgagcgctactccctggacgag
atcgtctaccgctccagctcggggggcctcctcgacgtgcgccacgacatggaggcgctg
gcccgcttctccggcgcctactggcgggacctcttcgactcccgcgtcggccgcaccacc
tggccctacggctccggcgtctggtccaagaaggagttcgtgctccccgagatcgacccg
gaccacatcgtctccctcttcgagggcaactccaacctcttctgggccgagcgcctcggc
cgcgaccatctcggcgggatgaacgacctctgggtcaagcactgcggcatctcccacacg
ggctccttcaaggacctcggcatgaccgtgcttgtcagccaggtcaaccgcctccgccgc
gccccgctgtcgcgccccatcgccggcgtcggctgcgcgtccacgggggacacctccgcc
gcgctctccgcctactgcgccgccgcggggatcccggccattgtcttcctccctgccaat
cgcatctcgctggagcagctcatccagcccatcgccaacggcgccaccgtgctttccctc
gacaccgacttcgatggctgcatgcggctcatcagggaggtgactgccgagctgcctatc
taccttgccaattcgcttaattccctccggctggaggggcagaagacagcggccattgag
atactgcagcagttcgattgggaggtgcccgattgggtgattgtgccgggaggcaatctg
gggaacatatatgcgttctacaagggatttgagatgtgccgtgttcttgggcttgttgat
cgtgtgccgcggcttgtctgtgcacaggcagccaacgcaaacccgctctatggctattac
aagtcaggctggaccgagttccaacctcaggtggccagaccaacatttgcatcagcgatt
cagatcggtgacccggtgtctgtcgaccgagctgtggtcgcgctcaaggcaacgaatggc
attgtcgaggaggccacagaggaagagctcatgaacgcaatgtcactcgctgaccgcact
gggatgtttgcttgcccacatactggggttgcgctcgccgccctgttcaagctcagggac
cagcgcatcatcgggccaaatgatcgcacggtggtcgtcagcacagctcacggcctgaag
ttctcgcagtcaaagatcgactaccatgatagtaagatcgaggacatggcttgcaagtac
tccaacccgcctgtgagcgtgaaggctgactttggcgccgtcatggatgtgctgaagaag
aggctcaagggtaagctctga

DBGET integrated database retrieval system