KEGG   Sorghum bicolor (sorghum): SORBI_09g030200Help
Entry
SORBI_09g030200   CDS       T01086                                 

Gene name
SORBIDRAFT_09g030200, Sb09g030200
Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sbi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 254 aa AA seqDB search
MSYYGSSSSGGRSSRRVDYGRTYVVRPKGRHLATFVWLHGLGDNGASWSQLLDSLPLPNI
KWICPTAASRPVAAFGGFPCTAWFDVEDTSIDGRDDIEGLDASAAHIANLLSSEPSDVKL
GIGGFSMGAAVALHSAACYAQGKFTSGIPYPITLNAVISLSGWLPCSRTLRSKMESSHIA
IRRAASLPILLGHGRVDEVVVYRNGERSAEILRNSGFSFLTFKPYNGLGHYTIPEEMDDL
CKWLSSSLGLSRSR
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgagctattacggcagcagctcttctggtggacgaagcagtaggagagtcgactatggg
aggacatatgtggtgaggccaaagggaaggcacctagccacctttgtgtggctccatggc
ctaggtgacaatggtgctagctggtcccagctcctggattctcttcctctaccaaatatc
aagtggatatgccccactgctgcaagccggcctgtcgcagcttttggtggattcccttgc
actgcatggtttgacgttgaggacacatctatagatggccgtgatgacattgagggactg
gatgcttcagctgcacacattgcaaatctgctgtcatctgagccgtctgatgtgaagctt
gggattggtggtttcagcatgggtgccgctgttgctctccactcagcagcatgctatgct
cagggaaaattcacaagtggcattccctatccaatcacactcaatgcagtcatcagtttg
agtggctggctcccttgctcaaggaccctgaggagcaagatggagagttcacatattgct
ataagaagggctgcctccttgcccatcctgcttggtcatggaagagtggatgaagttgtc
gtctacaggaatggcgagagatcagctgagattctgaggaactcaggattctcatttctg
actttcaagccctacaacgggttgggccattatacaatccctgaagaaatggacgatctc
tgcaagtggctcagctcatcgcttggcctcagccgatctcgctaa

DBGET integrated database retrieval system