KEGG   Sorghum bicolor (sorghum): SORBI_10g003670Help
Entry
SORBI_10g003670   CDS       T01086                                 

Gene name
SORBIDRAFT_10g003670, Sb10g003670
Definition
hypothetical protein
Orthology
K05759  
profilin
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Exosome [BR:sbi04147]
 Exosomal proteins
  Proteins found in most exosomes
   SORBI_10g003670 (SORBIDRAFT_10g003670)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 131 aa AA seqDB search
MSWQTYVDDHLMCEIDGQHLSAAAIFGLDGSLWAQSTGFPQLKPEEVAAITKDFDEPGTL
APTGLFVGGTKYMVIQGEPGAVIRGKKGTGGITIKKTGMALIIGIYDEPMTPGQCNMVVE
RLGDYLVEQGF
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtggcagacgtacgtcgacgaccacctgatgtgcgagatcgatggccagcacctc
agcgccgccgccatcttcggcctcgacggcagcctctgggcgcagtccacgggcttcccc
cagttaaagcctgaggaggttgctgcgatcacgaaggactttgatgagcctggtactctt
gcaccaactggtctttttgttggaggtacaaagtacatggtgatccaaggtgaacctgga
gctgtcatccgaggaaagaagggaactggaggcattactatcaagaaaactggcatggcc
ttgattattggtatctatgatgagccaatgactccagggcaatgcaatatggtggtggag
aggctcggagattacctggtcgagcagggcttctaa

DBGET integrated database retrieval system