KEGG   Sorghum bicolor (sorghum): SORBI_10g003810Help
Entry
SORBI_10g003810   CDS       T01086                                 

Gene name
SORBIDRAFT_10g003810, Sb10g003810
Definition
hypothetical protein
Orthology
K14512  
mitogen-activated protein kinase 6 [EC:2.7.11.24]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Environmental Information Processing
  Signal transduction
   04075 Plant hormone signal transduction
    SORBI_10g003810 (SORBIDRAFT_10g003810)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SORBI_10g003810 (SORBIDRAFT_10g003810)
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SORBI_10g003810 (SORBIDRAFT_10g003810)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 402 aa AA seqDB search
MDGGGQPPDTEMTDAGAGGGGQQPPPAQQQPQQAAGGGGMMENIQATLSHGGRFIQYNIF
GNVFEVTAKYKPPILPIGKGAYGIVCSALNSETAEQVAIKKIANAFDNKIDAKRTLREIK
LLRHMDHENIVAIRDIIPPPQREAFNDVYIAYELMDTDLHQIIRSNQALSEEHCQYFLYQ
ILRGLKYIHSANVLHRDLKPSNLLLNANCDLKICDFGLARTTSETDFMTEYVVTRWYRAP
ELLLNSSEYTAAIDVWSVGCIFMELMDRKPLFPGRDHVHQLRLLMELIGTPNEADLDFVN
ENARRYIRQLPRHARQSFPEKFPHVQPLAIDLVEKMLTFDPRQRITVEGALAHPYLASLH
DISDEPVCSMPFSFDFEQHALSEEQMKDLIYQEALAFNPDYQ
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacggcggggggcagcccccggacacggagatgacggacgccggcgcgggcggcggg
gggcagcagccgccgccggcgcagcagcagccgcagcaggcggcaggcgggggcgggatg
atggagaacatccaggcgacgctcagccacggcggccgcttcatccagtacaacatcttc
ggcaacgtgttcgaggtcaccgccaagtacaagccccccatcctccccatcggcaagggc
gcctacggcatcgtctgctcggcgctcaactccgagacggcggagcaggtggccatcaag
aagatcgccaacgccttcgacaacaagatcgatgccaagcgcaccctccgcgagatcaag
ctgctccgccacatggaccacgagaatattgttgcaataagggatatcatacctcctccg
cagagggaggcattcaatgatgtgtatattgcttatgaattgatggatactgatctgcat
caaattattcgttcaaatcaagctttgtcagaggagcactgtcagtattttctttatcaa
attcttcgtggcttgaagtatatacattcagcaaatgttcttcaccgtgacttgaagcct
agcaatcttcttttgaatgcaaactgtgacctcaagatatgtgattttgggcttgctcga
accacctcagaaactgattttatgactgaatatgttgtcacaagatggtacagagcacca
gagcttttgttgaactcctctgaatatactgctgccattgatgtgtggtctgtgggttgt
atatttatggaactgatggaccgaaaacccctgtttcctggaagagaccatgtccatcag
ctacgtctactaatggagctcattgggacaccgaatgaggctgatcttgattttgtaaat
gagaatgcaagaagatatatccgccaacttccccggcatgctagacagtcctttcctgaa
aaatttccacatgttcaacctttagcaattgacctggtggaaaagatgctgacttttgat
cctagacagagaataactgttgaaggcgcacttgcacacccttacttggcatcacttcat
gacataagtgatgagccagtctgctcaatgcccttcagctttgactttgagcagcatgca
ttgtctgaagaacaaatgaaggatctgatctaccaagaggctcttgcattcaaccctgat
taccagtag

DBGET integrated database retrieval system