KEGG   Sorghum bicolor (sorghum): SORBI_10g007800Help
Entry
SORBI_10g007800   CDS       T01086                                 

Gene name
SORBIDRAFT_10g007800, Sb10g007800
Definition
hypothetical protein
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:sbi01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbi01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbi00010]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sbi00260]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 335 aa AA seqDB search
MAGVLSHHALASSQSHWCSAKNYRFEKRTGSARLVYVKGSCGSGSRKLGLVWASSSQQSS
VMEPMHLPSDGNSGHTPKKSSESALILIRHGESLWNEKNLFTGCVDVPLTPKGVEEAIEA
GKRICNIPIDVIYTSSLIRAQMTAMLAMMQHRRKKIPVIMHNESEQAHRWSQIYSEETRK
HSIPVITAWQLNERMYGELQGLNKQETADRFGKEQVHEWRRSYDIPPPNGESLEMCAERA
VAYFKDQIVPQLVAGKHVMVAAHGNSLRSIIMHLDKLTSQEVISLELSTGIPMLYIFKEG
KFIRRGSPVGPSEASVYAYTRTLAKYRQKLDSMVQ
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggctggggttctttctcaccatgcgctggcatcttcgcaatcccactggtgcagtgca
aagaactatagattcgaaaagaggacgggcagtgcccgcttggtttatgtaaagggaagt
tgtggttcaggcagccgaaaactgggtttggtttgggcctcgagctcgcagcagtcttct
gtcatggagccgatgcacctaccatcggatggcaacagtggccacaccccaaagaaatca
agtgaaagcgctcttatattgattcggcatggtgaatccctgtggaatgagaaaaatctg
tttactggctgtgttgatgtacccctgacaccaaagggtgttgaggaggccattgaggca
ggtaaaaggatatgcaatatcccaatcgatgtaatatatacttcatcactgattcgtgct
cagatgaccgcaatgcttgccatgatgcagcatcggcgcaagaagatcccagttatcatg
cataatgagagtgaacaagctcacaggtggagtcagatatacagtgaggagacaaggaaa
cactccattccagtcataacagcttggcaattgaatgaaagaatgtatggtgagttacaa
ggccttaataagcaagaaactgcagatcggtttggcaaagaacaagttcatgagtggcgc
cgcagttatgatatccctcccccaaatggagaaagcctagagatgtgtgctgagagagct
gttgcttatttcaaagatcagattgttccacaacttgtggctggtaaacatgtgatggtt
gctgcacatgggaattcacttcgttcaattataatgcatctggacaaactaacttctcaa
gaggtaataagccttgagctgtctactggcattcccatgctttacatattcaaggaagga
aagtttattcgccgtggcagcccggtaggaccttcagaggccagtgtttatgcttatacc
aggaccttggctaaatacagacagaagcttgatagtatggttcagtaa

DBGET integrated database retrieval system