KEGG   Sorghum bicolor (sorghum): SORBI_10g009590Help
Entry
SORBI_10g009590   CDS       T01086                                 

Gene name
SORBIDRAFT_10g009590, Sb10g009590
Definition
hypothetical protein
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SORBI_10g009590 (SORBIDRAFT_10g009590)
Enzymes [BR:sbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SORBI_10g009590 (SORBIDRAFT_10g009590)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C44
   SORBI_10g009590 (SORBIDRAFT_10g009590)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 591 aa AA seqDB search
MCGILAVLGVAEVSLAKRSRIIELSRRLRHRGPDWSGLHCHQDCYLAHQRLAIIDPTSGD
QPLYNEDKTVVVTVNGEIYNHEELKAKLKTHEFQTGSDCEVIAHLYEEYGEEFVDMLDGM
FSFVLLDTRDKSFMAARDAIGICPLYMGWGLDGSVWFASEMKALSDDCERFITFPPGHLY
SSKTGGLRRWYNPPWFSETIPSTPYNALFLREMFEKAVIKRLMTDVPFGVLLSGGLDSSL
VASVASRHLNETKVARQWGNKLHTFCIGLKGSPDLKAAKEVADYLGTVHHEFHFTVQEGI
DALEEVIYHVETYDVTTIRASTPMFLMSRKIKSLGVKMVISGEGSDEIFGGYLYFHKAPN
KKEFHEETCRKIKALHLYDCLRANKSTSAWGVEARVPFLDKSFINVAMDIDPEWKMIKRD
LGRIEKWVIRNAFDDEERPYLPKHILYRQKEQFSDGVGYSWIDGLKDHANQHVTDSMMMN
ASFVYPENTPTTKEGYYYRTIFEKFFPKPAARSTVPGGPSVACSTAKAVEWDASWSKNLD
PSGRAALGVHDAAYEDTPGEAPASADPVSDKGLRPAIGESLVTPVASATAV
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcctcgccgtcctcggcgtcgccgaggtctccctcgccaagcgctcccgc
atcattgagctctcgcgcaggttacggcaccgagggcctgattggagcggtttgcactgt
catcaggattgctaccttgcacaccagcggttggctattattgatcctacatctggagac
cagccattgtacaatgaggacaaaacagttgttgtaacggtgaatggagaaatatataac
catgaagaactgaaagctaagttgaaaactcatgaatttcaaactggcagtgactgtgaa
gttatagctcatctttacgaagaatatggggaagaatttgtggatatgttggatggaatg
ttctccttcgttcttcttgatacacgtgataaaagcttcatggcagctcgtgatgctatt
ggcatctgccctttatacatgggatggggtcttgatggatcagtctggtttgcttcagag
atgaaggcattgagcgatgattgtgaacgcttcataaccttcccccctgggcatctctac
tccagcaaaacaggtggtctaaggagatggtacaacccaccatggttttcagagacgatc
ccttcaaccccttacaatgctctcttcctccgggagatgtttgagaaggctgttattaag
aggctgatgactgatgtgccatttggtgtgcttttatctggtggacttgactcttctttg
gttgcatctgttgcttcacggcacttaaacgaaacaaaggttgccaggcagtggggaaat
aaattgcatacattctgtataggcttgaagggttctcctgatcttaaagctgctaaggaa
gttgctgattacctcggcactgtacatcatgagttccacttcacagtgcaggaggggata
gatgccttggaggaagtcatctatcatgttgagacatatgatgttacaacaatcagagcg
agtaccccaatgtttttgatgtcacgcaaaatcaaatctttgggggtgaagatggttatt
tctggagaaggttcagatgaaatttttggcggttacctttattttcacaaggcaccaaac
aagaaagaattccatgaggaaacatgtcggaagataaaagcactacatctgtatgattgc
ttgagagctaacaaatcaacttctgcctggggtgttgaggctcgtgttccattccttgac
aaaagtttcatcaatgtagcaatggacattgatccggaatggaagatgataaaacgtgat
ctcggtcgaattgagaaatgggttatccgtaatgcatttgatgacgaggagcggccctat
ttacctaagcacattctttacaggcaaaaggaacagttcagtgatggtgtcggctatagt
tggatcgatggattgaaagaccatgccaaccaacatgtcacggattccatgatgatgaat
gctagctttgtttacccagagaacacacccacaacaaaagaagggtattactacagaaca
atattcgagaaattcttccccaagcctgcagcaaggtctactgttcctggaggtcctagc
gtggcatgcagcaccgccaaagctgttgaatgggacgcatcctggtccaagaaccttgat
ccatctggtcgtgctgctctgggtgttcacgatgctgcgtatgaagatactccaggggaa
gctcctgcctctgctgatccggtctcagacaagggccttcgtccagctattggcgaaagt
ttagtgacaccagttgcttcagccacagctgtctaa

DBGET integrated database retrieval system