KEGG   Sorghum bicolor (sorghum): SORBI_10g022820Help
Entry
SORBI_10g022820   CDS       T01086                                 

Gene name
SORBIDRAFT_10g022820, Sb10g022820
Definition
hypothetical protein
Orthology
K06067  
histone deacetylase 1/2 [EC:3.5.1.98]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 518 aa AA seqDB search
MDASAGGGGNSLPTTGADGSKRRVCYFYDAEVGNYYYGQGHPMKPHRIRMTHALLGRYGL
LDQMQVLRPHPARDRDLCRFHADDYVAFLRSVTPETQQDQIRALKRFNVGEDCPVFDGLY
SFCQTYAGGSVGGAVKLNHGHDIAINWAGGLHHAKKCEASGFCYVNDIVLAILELLKYHQ
RVLYVDIDIHHGDGVEEAFYTTDRVMTVSFHKFGDYFPGTGDIRDVGHSKGKYYSLNVPL
DDGIDDESYQSLFKPIMGKVMEVFNPGAVVLQCGADSLSGDRLGCFNLSIKGHAECVRFM
RSFNVPLLLLGGGGYTIRNVARCWCYETGVALGHELTDKMPPNEYYEYFGPDYTLHVAPS
NMENKNTRHQLDDIKSKLLDNLSKLRHAPSVQFQERPPEAELPEQDEDKENPDERRDADS
DVEMNDAKPLDDYGRRGSIQNLRMKKESAETEAVDQDVNSAAAEHSRGTGPVADGVGSSK
QTFPNDTTPMSIDEPNVLKVEQQSPNKLQDQPTMHQKP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atggacgcgtctgccggcggcggcggcaactccctgccgaccactggcgcggacgggtcg
aagcgccgcgtctgctacttctacgacgcggaggtgggcaactactactacgggcagggc
cacccgatgaagccgcaccgcatccgcatgacccacgcgctgctcggccgctacggcctc
ctcgaccagatgcaagtgctccgccctcaccctgcccgcgaccgcgacctctgccgcttc
cacgccgacgactacgtcgccttcctccgctccgtcacccccgagacgcagcaggaccag
atccgcgcgctcaagcgcttcaacgtcggcgaggactgccccgtcttcgacggtctctac
agtttctgccagacctacgcggggggctccgttggcggcgccgtcaagctcaaccacggc
catgacatcgccatcaactgggccggcggactccaccacgccaagaagtgcgaggcctcc
gggttctgctatgttaatgacatcgtcctcgccatcctcgagctactaaagtatcaccag
cgcgttctgtacgtggatattgatatccaccacggggacggcgtggaggaggctttttac
accacagaccgggtcatgacggtctcattccacaagtttggggattatttccctgggaca
ggggacattcgtgatgttgggcactcaaagggtaaatattactccctgaatgttccgctg
gacgacggtattgatgatgaaagctatcagtcgttgttcaagccaataatgggtaaggtg
atggaggtcttcaaccctggtgcagttgtcctccagtgtggtgcagattcattatcaggt
gacagattgggctgtttcaacctctctattaagggtcatgcagaatgtgtaagatttatg
aggtccttcaatgtcccgctgttgctgcttggtggtggaggttataccataagaaacgtt
gcacggtgttggtgctatgagacaggagttgcccttggtcatgagctcactgacaagatg
ccacctaatgagtactatgagtattttggtccagattacactctacatgttgctccaagt
aacatggagaataaaaacacacggcatcaattggatgatataaaatcaaaacttctagat
aatctttcgaaactccgacatgctcctagtgttcaatttcaagagcgacctcctgaggct
gagttacctgagcaagatgaagacaaagagaatcctgatgaaagacgtgatgctgattct
gatgtggaaatgaatgatgccaagcctttggatgactatgggaggaggggcagcatacag
aatttaagaatgaagaaagagtctgctgagacagaggcagttgatcaggatgttaatagt
gcagctgcagaacattctagaggcactggacctgtggctgatggagttggttcctcgaaa
caaacctttccgaacgacactactccgatgtccatagatgaaccaaacgttctgaaagtt
gagcaacagagtccaaacaaattgcaggaccaaccgacgatgcaccagaagccatga

DBGET integrated database retrieval system