KEGG   Sorghum bicolor (sorghum): SORBI_10g025220Help
Entry
SORBI_10g025220   CDS       T01086                                 

Gene name
SORBIDRAFT_10g025220, Sb10g025220
Definition
hypothetical protein
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SORBI_10g025220 (SORBIDRAFT_10g025220)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SORBI_10g025220 (SORBIDRAFT_10g025220)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SORBI_10g025220 (SORBIDRAFT_10g025220)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 399 aa AA seqDB search
MPELPEVEAARRALQAHCVGRRIARCAVADDDKVVVAAAGRAAFERAMVGRTIVAARRRG
KNLWLQLDAPPFPSFQFGMAGAIYIKGVPVTNYKRSVVNSEEEWPSKYSKFFAELDDGLE
FSFTDKRRFARVRLFEDPETVPPISELGPDALFEPMSVDDFLDSLGRKKIGIKALLLDQS
FISGIGNWIADEVLYQSRIHPLQIASNLPRESCEALHRSIQEVVKYAVEVDADMDRFPKE
WLFHHRWGKKPGKVNGKKIEFITAGGRTTAYVPQLQKLIGIQSSKMVSANLEQLAENVDT
KDSGTEGEDADILKPKKRVATSRAARGQQNKDTVGASSRKARGNAGATKKPDADVEPAEP
ETVVTESNGEQILDQPNSNAVNKSDQVTRRSSRKVKPRK
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgccggagctgccggaggtggaggcggcgcggcgggcgctgcaggcgcactgcgtgggg
aggcgcatcgcgcgctgcgccgtggcggacgacgacaaggtggtcgtggccgccgccgga
cgcgcggccttcgagcgcgccatggtcggccggaccatcgtcgccgcgcgccggaggggc
aagaacctctggctccagctcgacgcgccgcccttcccgtccttccagttcgggatggca
ggcgcgatatatatcaaaggcgttcctgtgacaaattataagagatccgttgtcaattcc
gaagaggagtggccatccaaatactctaaattctttgctgagcttgatgatggtttggag
ttctctttcactgataaacggcgctttgcaagagttcgtttgtttgaagatcctgaaact
gtacccccaatttctgagctgggtccagatgctctgtttgagccaatgtctgttgacgat
ttcttggactccctgggtagaaagaagattgggataaaagctcttttacttgatcagagc
tttatatcaggcattggtaattggattgcagacgaggtgctttaccagtcaaggatccat
ccattacagattgcttcgaatctacctagggagagttgtgaagcactgcaccgaagtatc
caagaggttgtgaaatatgctgttgaagttgatgctgacatggaccgctttccaaaggaa
tggttatttcatcatcgttggggcaagaagcctggcaaagtcaatggaaagaaaattgaa
ttcatcacagctggtggcaggactactgcctacgtgccgcaattgcaaaaactgattgga
atccagtccagcaaaatggtatccgctaacctggaacaactagctgagaacgttgatacc
aaggattcagggactgagggagaagatgcagatattttgaagccaaaaaagcgagtcgca
acatccagggctgccaggggacaacaaaacaaagatactgtgggcgccagttcgagaaaa
gcaaggggaaatgctggtgccactaagaaaccagatgccgatgttgagcctgctgaacca
gaaacagttgtcaccgaaagcaacggtgagcaaattttggaccaacccaacagtaatgct
gtcaataaatcagatcaggttacaagaagatcatcaaggaaagtgaaaccccgtaagtaa

DBGET integrated database retrieval system