KEGG   Sorghum bicolor (sorghum): SORBI_10g026010Help
Entry
SORBI_10g026010   CDS       T01086                                 

Gene name
SORBIDRAFT_10g026010, Sb10g026010
Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 979 aa AA seqDB search
MALPACTTQCPTMEGFRLAVHVDLLAAVVGLVLFSAAVVAVRRAASRYFVVDAAGFAASY
DDHHHDPMGNPQEQGAAAADLMGPCAACGGVASKKCSRCKRVRYCSQECQTNHWQSDHKF
KCKQMKSLDPADKLSSGGEANNKKTSGFGRISLVPACKKISKGQVLFPYDEFLKLYNWKE
FDFVPCGLMNCGNSCFANVVLQCLSCTRPLVSYLLGKDHSRECSMRHEDWCFLCELQCHI
HRASGSLHPFAPTNILSHLPNIGGNLGFGRQEDAHEFMRFAIDKMQSACLDEYGGEKAVD
LSTQETTIIQHIFGGRLQSQVQCTACGMVSNRYDNMMDLTVEIQGDAESLEKCLDQFTAI
EWLDGDNKYKCDGCNDYVKARKHLSVHQAPNILTITLKRFQSGRFGKLNKRVTFPMELDL
TPYTSCTDGSDLYDLYAVVVHLDMLNASFFGHYICYIKGYQGRWYKIDDCKVMVVDEEEV
HAQGAYMLLYSRRTARPKPLVTVDESVKQQQQCKLLPSNGQSHMILADATLNCESSLKTT
EDPLRQDCESNNGSLHEMDIKDQESDLDLCTSIEDDKFISNENLHIPGSHVLEDTRAPDS
FAEQCEVQLGPPLEGGRITMSSVQFGSSTCKASSEHSFAEQCEVPAPCIDSVDYMDLDTE
AAAEVVLDDSVGRPNNNSEIPTANGMSGEPKPSFSSGFFDKPSRKRSSFAEEDSAGSPRK
LNGYCNGHLSSLEQGILANSGSEKCNGDTLATSSNGNCYAVNGDAQSRNDSLDADKGDVP
FVSHGFEPRPYKVLSDSNNNCSRTSNGKPKAYQGDMSFLPRGFLGRSSSRGISVKADDGL
PFSNGASSSFGNGKSKSSNHSSSIGGLSPGFLTRHRRESIALGTSSDISMDTKSNGAAVM
PEGAEEMVSDCTTNGSSFQIRASDHLDENGLAILHTKSNSCGQENDSNGTPSMNHDGSEH
GLRRRITSKFFEQDGIDAQ
NT seq 2940 nt NT seq  +upstreamnt  +downstreamnt
atggcgttgcctgcgtgcaccacgcaatgcccaacaatggaagggtttagactcgctgtt
cacgttgatctcttggcggccgtcgtcggcctcgtgctcttctccgcggccgtcgtcgcc
gtgcgccgcgccgcctcgcgctacttcgtcgtcgacgccgcggggttcgccgcctcctac
gacgatcaccaccacgacccgatgggtaacccgcaggagcagggggccgccgcggcggac
ctcatggggccctgcgccgcgtgtggtggcgtcgcctccaagaagtgctctcggtgcaag
cgcgtgcggtactgttcccaagaatgccagacaaatcattggcaaagtgatcacaaattc
aagtgcaaacaaatgaaatcattggatcctgctgacaagttatccagtggaggtgaggcc
aacaataaaaaaacatcaggtttcggtcgcatctcattggtgcctgcctgtaaaaagata
agcaagggtcaggttctctttccttatgatgaatttttaaagttgtacaactggaaggaa
tttgatttcgtaccttgtgggcttatgaactgtggcaacagttgctttgctaacgtggtt
ttacaatgtctctcatgcacgagaccgcttgtgtcctatctattaggaaaggaccatagc
agggaatgttctatgagacatgaagattggtgttttttatgtgagctgcaatgtcatatt
cacagagctagtgggagtttgcacccatttgctcctacaaacattctttctcatctgcca
aatattggtggcaatcttggctttggtaggcaagaggatgctcatgaattcatgaggttt
gcaattgataagatgcaatctgcttgccttgatgaatatggaggtgagaaggctgtagat
cttagcacccaagagacaaccattattcagcacatatttggtgggcggctgcagtcacag
gttcaatgcactgcatgtggaatggtctcaaaccgctatgataatatgatggatttgact
gttgaaattcaaggtgatgccgaatcattggaaaaatgcttggatcagttcactgctatc
gagtggcttgatggggataataagtacaaatgtgatggatgcaacgactatgtgaaagca
cggaagcatctttcagttcatcaagctccaaatatacttactatcactctcaaaagattc
cagagtggtagatttgggaaactgaataagagagttacattccctatggagttagatctg
acaccatacacgagttgcactgatggaagtgacctgtatgatctctatgctgtggttgtt
catctggatatgctgaatgcgtcattttttgggcactatatatgctatatcaaaggttat
caaggaaggtggtataaaattgatgactgcaaggttatggttgttgatgaggaggaagta
catgctcaaggcgcttatatgcttttatatagcaggagaacagctcgtcccaagccactt
gttacagttgatgagtctgtgaaacagcaacaacagtgcaaattgctcccttcaaatgga
caaagccacatgatactagcagatgcaacattaaactgtgaatcatctttgaagactaca
gaagatccgttacgacaggattgtgaatccaataatggatctttgcatgaaatggatatt
aaggaccaggagtcagacttggatctatgtacaagcattgaagatgacaaattcattagc
aatgaaaatctacatataccaggttcacatgttcttgaagatactagagctccagattcc
tttgcagagcaatgcgaggtgcaacttggccctcctttagaaggtggtcgtattacgatg
agctctgtgcagtttggcagctccacatgcaaagcatcttcagaacattcctttgcagag
caatgcgaggtgcctgccccatgtattgattcagttgactatatggatcttgataccgaa
gctgctgccgaagttgtcttagatgattcagttgggaggccgaataataactcagaaatt
ccaactgcaaatgggatgtcaggagaaccgaaaccatcattttcctctggtttttttgat
aagccctcaagaaaaaggtcttcctttgcagaagaggatagtgctggttctcctcgaaag
ttaaatggctattgcaatggacatctcagcagtctagagcaaggaattcttgccaactct
ggaagtgaaaagtgcaatggagatacactcgcgacatccagtaatggcaattgctatgca
gttaatggtgatgcacaatctcgcaatgattccttggatgcagacaagggagatgtgcct
tttgtttctcatggctttgagccaagaccttacaaagtactatcagacagcaacaacaat
tgcagtaggacaagcaatgggaaacctaaagcttaccaaggggacatgtcatttttacct
cggggcttccttggaaggtctagttccagaggaatttcagtcaaagcagatgatggcttg
ccatttagtaatggtgcatcatcatcctttgggaatggaaaaagtaagtcaagtaaccac
tcatcttctataggtggcttgtctcctggtttccttacaaggcatcgcagggaatccatt
gccctaggcacaagctctgacatttcaatggatacaaaatctaatggtgctgcagtaatg
ccagagggtgcagaggaaatggtttcagattgtacgacaaatggatcttcgttccaaata
agagcgtccgaccaccttgatgaaaatggccttgcaattttgcacacaaaaagtaacagc
tgtgggcaagaaaatgacagtaatggaacccccagcatgaatcatgatggttctgaacat
ggactgcgccgaagaataacctcaaaattttttgagcaggatggtattgatgcccaataa

DBGET integrated database retrieval system