KEGG   Sorghum bicolor (sorghum): SORBI_10g026110Help
Entry
SORBI_10g026110   CDS       T01086                                 

Gene name
SORBIDRAFT_10g026110, Sb10g026110
Definition
hypothetical protein
Orthology
K08248  
mandelonitrile lyase [EC:4.1.2.10]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Cyanoamino acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    SORBI_10g026110 (SORBIDRAFT_10g026110)
Enzymes [BR:sbi01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.10  (R)-mandelonitrile lyase
     SORBI_10g026110 (SORBIDRAFT_10g026110)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 419 aa AA seqDB search
MPLVNASYEWVERLMTFQPAVHGWQAAVRAALLEANVTPWNGFTVDHVTGTKVGATTFDA
SGRRRSAADLLAFARPSRLRVAVRATVTRIMTNPIDPAARRGRFPQPTIAAIGVVYQDHL
LDQHQALLRPGGEVILSAGSLGSPQLLLLSGIGPAPDLSNLGIPVSADIPDVGKHMYDNP
RNGISFIPSVPIDHSLIQVVGIPSANGTASYLEAASYIVPLAPELRSSSPFLGSSSPLYV
TVATIMEKVPGPLSEGSLWLSSTNPLESPALRFNYLSRPEDLARCILGVRHVAEILEGRS
LDGFRSAVGSTNRRGSVRRDFRIVGTALPVDWRTNDIALANYCQQTVATLWHYHGGCVAG
KVVDRNFRVIGARAIRVVDASTFSETPGTNPQATILMMGRYVGLKMIEERHSRRPVIPP
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggtgaacgcgtcatacgagtgggtggagaggctgatgacgttccagccggcg
gtgcacgggtggcaggcggcggtgagggcggcgctgctggaagcaaatgtgacgccgtgg
aacggcttcacggtggaccacgtcactggcacaaaggtcggcgccacgacctttgatgca
tcaggccgacggcgcagcgccgcggacctccttgcgtttgcgcgtcctagccgtctccgt
gttgccgtccgagctacagttacgcgcatcatgaccaacccgattgaccctgctgcgcgc
cgtggaaggtttccgcaaccaacaatagcagcaattggtgttgtttatcaggaccatctc
cttgatcagcaccaagcccttctgcgcccaggtggggaggttatactttcagcaggttcc
ctggggagtccccaattgctgcttctcagtggcatcggccctgctcctgatctttccaac
cttggtatccctgtttctgctgacatccccgatgttggcaaacatatgtacgacaaccct
cgcaatggcatctccttcatcccgtcagttcctattgatcactctcttattcaggtcgtt
ggcatcccgtcagctaatggaactgcctcataccttgaggcagcatcatacattgtccca
cttgctccagagttgagatcttctagtcctttccttggctcgtcttctccactctatgtt
actgttgcaactatcatggaaaaggttccgggaccattatctgagggttcactatggctt
tcatcaacgaatccattggagagtcctgctctgcgcttcaactacttgagccgtcctgag
gacttggcacgatgtatcctgggtgtgcgtcatgtggcagaaatactcgagggcagatca
ttggacggatttcgttcggcagttggatcgacaaatagaagagggtcagttaggagggat
ttcaggattgttgggacagcactgccagttgactggagaacaaacgatatagctctagca
aattactgtcagcagactgttgcaacgttatggcattatcatggagggtgtgtcgctggg
aaggtggttgataggaatttccgggtaattggtgctcgtgcaattcgtgtggtagatgca
tcaacgttcagtgagacgcctgggacaaatcctcaggctacaattttgatgatgggcagg
tatgtgggcctgaagatgattgaggagagacacagtagaaggccagttataccgccatag

DBGET integrated database retrieval system