KEGG   Sorghum bicolor (sorghum): SORBI_10g028780Help
Entry
SORBI_10g028780   CDS       T01086                                 

Gene name
SORBIDRAFT_10g028780, Sb10g028780
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     SORBI_10g028780 (SORBIDRAFT_10g028780)
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   SORBI_10g028780 (SORBIDRAFT_10g028780)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   SORBI_10g028780 (SORBIDRAFT_10g028780)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
10
AA seq 369 aa AA seqDB search
MAMMVDPPNGMASQGKHYYTMWQTLFEIDTKYVPIKPIGRGAYGIVCSSVNRETNEKVAI
KKINNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPAHRRSFKDVYLVYELMDTDL
HQIIKSSQPLSNDHCQYFLFQLLRGLKYLHSAGILHRDLKPGNLLVNANCDLKICDFGLA
RTNNTKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVWSVGCIFAELLGRKPIFPGTECL
NQLKLIVNVLGTMSEADLEFIDNPKARKYIKSLPYTPGIPLTSMYPQAHPLAIDLLQKML
VFDPSKRISVTEALEHPYMSPLYDPSANPPAQVPIDLDIDENLGVDMIREMMWQEMIHYH
PEVLTRMTM
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgatggtggatccccccaatggcatggcgagtcaaggaaagcattactatact
atgtggcagacactatttgagatcgacaccaagtatgtgccaatcaagcccattggaaga
ggagcttacgggatcgtttgctcatctgttaaccgtgagactaatgaaaaagtagcaata
aaaaagataaacaacgtctttgacaaccgtgtggatgcgctgaggacactgagggaactg
aaacttcttcggcacctaaggcatgagaatgttattgctctcaaggatataatgatgcca
gcgcatagaaggagcttcaaggacgtttacttggtttatgagctcatggacactgatctg
catcaaataattaagtcatctcaaccactttccaatgatcactgccagtatttccttttt
cagctgctccgaggcctcaagtaccttcattcagctggaatactccatagagacctaaag
ccagggaatctcctggttaatgcaaattgtgatttgaagatatgtgattttgggcttgcc
cgcacaaacaacaccaaaggtcagtttatgacagaatatgttgtcacccgctggtacagg
gcccctgagctgctgctatgctgtgacaactacggtacctccatagatgtctggtcagtt
ggctgcatatttgcagagctacttggccgcaagccgatttttccaggaactgagtgcctc
aatcaactcaagctcattgtcaatgttcttggcaccatgagcgaggctgaccttgagttc
attgacaacccaaaagcccgcaagtatatcaagtctcttccatacaccccaggcattccc
ctcaccagcatgtacccacaagcacaccctcttgccatcgatctgttgcagaagatgctt
gtctttgatccctccaaaagaattagtgtcaccgaggctctagagcacccgtacatgtct
ccgctctatgatccaagtgcaaaccctcctgctcaggtgccaattgatcttgacatagat
gaaaatctcggcgtagacatgatccgggaaatgatgtggcaggagatgatccactaccat
cccgaggtcctcacaagaatgaccatgtga

DBGET integrated database retrieval system