KEGG   Shewanella baltica OS155: Sbal_0044Help
Entry
Sbal_0044         CDS       T00478                                 

Definition
alpha/beta hydrolase fold domain-containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sbl  Shewanella baltica OS155
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Sbal_0044
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Sbal_0044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(52198..53181)
Genome map
AA seq 327 aa AA seqDB search
MSQAKATFSTEHDLNTSEQQAFWQSVVQDTLITADGITLAYMMVKHPQAHTAIVLSSGRV
ESYLKYQELVFDLYQQGYSVYAIDHRGQGLSDRMTINPHMGHVRRFNDYIDDFALFMQKK
VLPQNDKQLMLLGHSMGGAIGTLYLKQHPDIFTAAAFSAPMYGIKLPMPKAFVRWLASKL
DTTLNGGEPNYVLGGQNYKPVPFKGNELTHCQSRYQAYRDLYDAAPKLQLGSPTNRWLTE
SLDAADTCVLATAQIRTPILILQASEDKIVDNAAQNLAVSTHCQLKVIAGAAHEIFMEKD
AYRNQALNYALDFFKRFAIKDEDKQAG
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgagccaagccaaagcgacattttcgactgaacacgatttaaatacctcagagcagcaa
gccttctggcaaagcgttgttcaagacacgctgatcacagctgatggcatcacgctggcc
tatatgatggtcaaacatccccaagcacataccgcaatcgttctcagtagtggccgagtt
gaatcctatttaaagtaccaagaattggtcttcgacttgtaccaacagggttactctgtt
tatgccatcgatcaccgtggccaaggattgtcggatcgtatgacaatcaatccgcacatg
ggccatgtgcgaagatttaatgattatattgatgattttgcactgtttatgcaaaagaaa
gtgttaccacaaaacgacaaacaactaatgctacttggccattcaatgggtggcgcgatt
ggcactttgtatctcaaacagcatcccgatatttttaccgccgcggcattttcagcgccc
atgtatggcatcaaattacctatgccaaaagcattcgtgcgctggttagccagtaagctc
gataccactctcaatggcggcgaacctaactatgtgcttggaggacagaactataaaccg
gttcccttcaaaggaaatgagctaacccattgccaaagtagataccaagcctatcgagac
ttgtatgacgcggcccctaagttacaactcggttccccaactaaccgttggttgacagaa
tctttagatgcagcagacacttgcgtactggcaacggcgcaaattcgcacgccgatcctg
atactgcaagcgagtgaagataagattgttgataatgcggcccagaatcttgcggtgagc
actcattgtcaattgaaggtaatagcaggggctgcccatgagatttttatggaaaaagac
gcctatcggaaccaagccttaaattatgccctcgacttctttaaacgcttcgcaataaag
gacgaggacaaacaagctggataa

DBGET integrated database retrieval system