KEGG   Shewanella baltica OS155: Sbal_0105Help
Entry
Sbal_0105         CDS       T00478                                 

Definition
(GenBank) malate synthase
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00620  Pyruvate metabolism
sbl00630  Glyoxylate and dicarboxylate metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01120  Microbial metabolism in diverse environments
sbl01200  Carbon metabolism
Module
sbl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal_0105
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal_0105
Enzymes [BR:sbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal_0105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2431
Motif
Other DBs
NCBI-ProteinID: ABN59640
JGI: Sbal0105
UniProt: A3CYS7
Position
complement(117665..118228)
Genome map
AA seq 187 aa AA seqDB search
MNMSIIKSNQIQPNLNSLIAEEVLAVAQVNVAEHEKIANAKQFLDRLFPLNSGSHQDVSS
YVVYYQHLLAFFADGSHSGLRQPKQFVAFNGTKDAPCAIVLQDLGCHVELSFDRSGMIGA
RDVANLEDIQIGTSLNMVVGTPESRSAASRHWLSLLHAGMSSANDTQDKLFTAKDGSDYN
LKSIVNL
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgtcaattatcaagagcaaccagatccaaccgaatctaaacagcctcatcgca
gaagaagtgctagccgtggcccaagtgaatgtcgccgagcacgagaagatcgctaatgcg
aaacaattcctcgaccgcctctttccacttaactctggttcacaccaagatgtgagcagc
tatgtggtttactaccaacacctgttggccttttttgccgacggcagccacagtggttta
cgtcagccaaaacagtttgtggcctttaacggcactaaagatgcgccttgcgccatagtg
ttacaggacctaggttgccacgttgaactcagtttcgaccgcagtggcatgataggtgcg
agagacgttgccaatctggaagatatccaaatcggaacgtcattaaacatggtagtcgga
acaccagagtcacgttctgccgcatcgcgccattggctcagcctattacatgcgggaatg
tccagcgccaacgacacccaagataagttgtttaccgcaaaggatggcagcgattacaac
ttgaaaagtatcgtaaatttataa

DBGET integrated database retrieval system