KEGG   Shewanella baltica OS155: Sbal_0116Help
Entry
Sbal_0116         CDS       T00478                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sbl  Shewanella baltica OS155
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbl01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sbl00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(132787..133887)
Genome map
AA seq 366 aa AA seqDB search
MTDLPWKRIVVKVGSALIAPHKQGCSSHYLLGIAQFITYCRAQGIQVVLVSSGSVAAGWH
HFGEVDKPSVTVKKAMAAAGQADMMATWNKLFDFPTAQLLLTHGDLRNRDRYISIKDTIF
SLLEHGLLPIINENDAVTADKLKVGDNDNLSAMLAAAADADTLIICSDVNGLYTQNPHEN
PDAQLIKQVTEINAEIYAMAGGASSAVGTGGMRAKIQAAKKAISHGIETFIINGFDADSF
NQLLKGQNPGTLFTPDEKPMQDHLHWMTHTSQAQGEVIVENDFNISLDIHSEQLTSDDVV
AINGDFSAGDTILVRKGDGTKLAKAKSNYSSCLLSFITDQDDREFASEFQQKTGPIISEK
NIAILE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgacttaccctggaaacgcattgtcgttaaggtaggtagtgccctgattgcaccc
cacaaacaaggttgcagcagccactacttactcggcattgcccaatttattacttattgt
cgcgcccaagggatccaagttgtcttggtctcttcgggctcagtcgccgcgggatggcat
cactttggcgaggttgataaacctagcgtcacagtgaagaaagccatggcagcagctggt
caggccgatatgatggccacatggaacaagttatttgatttcccgaccgcacagctactg
ttaacccacggtgatttacgcaaccgagatcgttacatcagtattaaagatacgattttc
agcctactcgaacatgggctactgcctatcatcaacgagaacgatgccgtgaccgccgac
aagctcaaagttggcgataacgataatctctcggccatgttagccgcagcggccgatgcc
gatacactgattatctgttcggatgtgaatgggctttacacacaaaacccccatgaaaat
cccgatgcacagcttatcaagcaggtgaccgagattaatgccgaaatctacgccatggca
ggcggcgccagcagcgccgtcggcacaggtggtatgcgggctaagatacaagccgccaag
aaggcgatttcccacgggatcgagacctttattatcaatggttttgatgctgactcattc
aaccaattgttgaagggccaaaacccaggaaccttatttacccccgatgaaaagccaatg
caagatcacttgcactggatgacacatacctcgcaggctcagggcgaagtcattgttgaa
aatgactttaatatttccctcgacatccatagcgagcaattgaccagcgacgatgtcgtt
gccatcaacggggacttttctgccggtgacaccattttagtacgcaaaggtgatggtact
aaattggccaaggccaaatccaattacagcagttgtttacttagctttattacggaccaa
gacgatcgcgagtttgccagtgaatttcagcaaaagactggaccgatcatttccgagaaa
aacatcgccattctcgaataa

DBGET integrated database retrieval system