KEGG   Shewanella baltica OS155: Sbal_0355Help
Entry
Sbal_0355         CDS       T00478                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00230  Purine metabolism
sbl01100  Metabolic pathways
Module
sbl_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Sbal_0355
Enzymes [BR:sbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Sbal_0355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin MMR_HSR1 AAA_16 RsgA_GTPase AAA_33 AAA_29 AAA_22 ABC_tran cobW
Motif
Other DBs
NCBI-ProteinID: ABN59888
JGI: Sbal0355
UniProt: A3CZH5
Position
complement(394363..394995)
Genome map
AA seq 210 aa AA seqDB search
MTARGNLFIVSAPSGAGKSSLISALLKDKPADMQVSVSHTTRAPRPGEVDGQHYHFVNVE
QFKALIAENAFFEWAEVFGNYYGTSRHVIEHTLTQGIDVFLDIDWQGAEQVKAVMPDAVG
VFILPPSKAELERRLTGRGQDSSDVIASRMAQAVSEMSHYKEYDFIIVNDDFDTALADLR
AIIRSQRLTCASQIHAQNDMLNDLLAGQLS
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcacgcggaaatttatttattgtgtcggcgccaagtggcgcaggtaaatcctcg
ctgatctcggccttgcttaaagacaagcccgctgacatgcaggtttcggtatcacatacc
acccgcgcgccacgcccaggtgaagtcgatggtcaacactatcacttcgttaatgttgaa
caattcaaagcgttaattgctgaaaatgccttttttgaatgggcagaagtgttcggcaat
tactatggtacctcgcggcatgtgattgaacatacgctcacccaaggtatcgatgttttc
ctcgatatcgactggcaaggtgccgagcaagttaaagctgtgatgcccgatgccgttggt
gtgtttattctgccaccctcgaaagccgagctagaacgccgcctcactggccgtggacaa
gacagtagcgatgtgatcgccagccgtatggcacaagccgtatcggaaatgtcccactat
aaagaatatgattttattatcgtcaacgacgattttgacactgcgttagctgatttgcgt
gccatcattcgcagtcagcgcttaacctgtgctagtcagatccacgcgcaaaatgatatg
cttaacgatctgttggcaggccaactgtcatag

DBGET integrated database retrieval system