KEGG   Shewanella baltica OS155: Sbal_0391Help
Entry
Sbal_0391         CDS       T00478                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbl  Shewanella baltica OS155
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbl00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
436535..438019
Genome map
AA seq 494 aa AA seqDB search
MQKKYVVALDQGTTSSRAIVFDHDANIVSVSQREFTQLYPNPGWVEHDPMEIWASQSSVL
VEVLARAGIHSDEVAAIGITNQRETTVIWEKATGKPIYNAIVWQCRRSSEICEQLKAQGL
EEYVRENTGLLLDPYFSGTKIKWILDNVPNARAQAERGELLFGTIDTWLVWKLTEGKVHV
TDPTNAARTLLFNIHSLTWDNKLLEALDIPLSLLPEVKPSCSVYGTTRIAGEGSEIQVAG
MAGDQQAALFGQLCVEPGMAKNTYGTGCFLLMNTGTKAVRSNHGLLTTVAVGPKGEVNYA
LEGSVFMGGATIQWLRDELGLIRDASDTEYFASKVADTNGVYLVPAFVGLGAPYWDPNAR
GALFGLTRGANRNHIIRAALESIAYQSKDLLDAMTKDSGVSLKRLKVDGGAVANDFLMQF
QADITDVEVLRPSVCETTALGAAFLAGLAVGFWESVIELEHKACIDKHFIPNIDAETRVR
LYAGWQDAVARTRA
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaaaaaatacgtggtggccttagatcaaggcacgaccagctcaagggcgatagtg
ttcgatcacgacgcaaacattgtcagcgtgtcccagcgggaattcacccagttgtatcca
aatccgggttgggtcgagcatgatcccatggagatctgggcaagccaaagttcagtgtta
gttgaagtgctggcgcgcgcggggatccacagcgatgaagtggctgcaattggcattacc
aatcagcgggaaaccactgtcatttgggagaaagccacaggtaaacctatctataacgcg
attgtgtggcagtgccgtcgcagctctgaaatttgtgagcaactcaaagctcaaggatta
gaagagtatgtgcgtgaaaacacaggtctattactcgacccttatttttcaggcactaag
atcaagtggattctagataatgtgcccaatgcccgtgcgcaagccgagcgcggtgagttg
ttgttcggcactatcgatacttggctagtgtggaagttaaccgagggcaaagtgcatgtc
accgaccccaccaatgccgcccgtactctgctgtttaatatccatagcctgacttgggat
aacaagttacttgaagctttagacattcccttgtctttgttgcccgaagttaagccttcc
tgcagcgtgtatggcactacgcggattgccggtgaaggcagtgaaattcaagtcgcaggg
atggcaggcgaccaacaagcggcgctttttggccagctgtgtgtcgagcccggcatggcg
aagaatacctatggcactggctgttttttgttgatgaataccgggaccaaagcggtgcgt
tccaaccatgggttactgaccacagttgccgtggggccgaagggcgaagtgaactatgcc
ctcgaaggctcagtcttcatgggcggcgcgaccattcaatggctgcgggatgaactgggg
cttattcgtgacgccagtgatactgagtattttgcctctaaggttgcagataccaatggc
gtatatctggtgccagcctttgtgggactcggtgcgccctattgggatcccaatgcccgt
ggcgcactatttggtttaacccgtggcgccaaccgtaatcatattattcgggcggcgtta
gaatccattgcttatcagagtaaagatttactcgatgccatgaccaaagacagtggcgtt
agccttaagcgtttaaaggtggatggcggcgcggtcgccaatgattttttgatgcagttt
caagccgatatcaccgatgtcgaagtattaaggccgagtgtttgtgagacaacggctttg
ggcgcggcatttttagctgggctggcagtgggcttttgggagagtgtcattgagcttgaa
cataaggcttgtatcgataagcattttatccccaatattgatgccgagactcgggtgcgg
ttatacgcaggttggcaggatgccgtcgccagaactcgcgcctaa

DBGET integrated database retrieval system