KEGG   Shewanella baltica OS155: Sbal_0611Help
Entry
Sbal_0611         CDS       T00478                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
  KO
K13938  dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.50 1.5.1.3]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00670  One carbon pool by folate
sbl00790  Folate biosynthesis
sbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal_0611
   00670 One carbon pool by folate
    Sbal_0611
Enzymes [BR:sbl01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Sbal_0611
    1.5.1.50  dihydromonapterin reductase
     Sbal_0611
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase GDP_Man_Dehyd RmlD_sub_bind
Motif
Other DBs
NCBI-ProteinID: ABN60140
JGI: Sbal0611
UniProt: A3D077
Position
696341..697087
Genome map
AA seq 248 aa AA seqDB search
MTSPIIITGVGKRIGYALAKHFLAQGQQVIGTYRSHYDSIDELNALGATLYPCDFYDDTQ
VQSLIDELTQLPQIRAIIHNASDWLPDPVLTKNEPLKSTTFAPSQVLQRMMQVHVSVPYQ
LNLALEAQLRAAAGDEIGGSDVIHITDYVAEKGSQKHIAYAASKAALHNLTLSFAAKFAP
EVKVNSIAPAMILFNTGDDAAYQQKTLAKALLPKEAGNAEIIELVDYLLNSRYVTGRCHN
VDGGRQLK
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgacatctcccatcataatcacaggcgtgggtaaacgcataggttacgccttagccaaa
cattttctcgcccaaggtcagcaggtgattggtacttatcgcagccattacgatagcatt
gatgagctgaacgctttaggtgcgactctgtatccctgcgatttttatgacgatacccaa
gtgcaatccttaattgatgagttaactcaactgcctcaaattcgcgccattattcacaat
gcctcggactggctgcctgatcctgttcttacaaagaatgagcctttaaagagtaccact
tttgcaccgagccaagtgctgcagcggatgatgcaagtgcatgtgagcgtgccctatcag
ttgaacttggccttagaggcgcagctacgtgccgctgctggcgatgaaatcggcggcagt
gatgtgattcatattaccgattacgtggcagagaagggcagtcagaagcacatagcttac
gccgccagtaaagccgcgctgcacaatttgacgttatcctttgccgccaaatttgcgccc
gaggtgaaagtgaattcgattgcgccggcgatgattctctttaataccggtgatgacgcc
gcctatcagcaaaaaaccttagcaaaagcgctgttgccgaaagaggcggggaatgcggag
attattgaactcgtggactacctgcttaatagccgttacgtcacaggtcgttgccataat
gtcgatggcggccgccagttaaaatag

DBGET integrated database retrieval system