KEGG   Shewanella baltica OS155: Sbal_0651Help
Entry
Sbal_0651         CDS       T00478                                 

Definition
alkaline phosphatase
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
sbl  Shewanella baltica OS155
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal_0651
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sbal_0651
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal_0651
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sbal_0651
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
739007..740773
Genome map
AA seq 588 aa AA seqDB search
MNRTVTRRDFLAMSAKGVGVAVISYGLMGCSDSNDDNSVPAQFLHGIASGDPAIDAVILW
TRVTPESEGDVKVSWQVASDAAFSQLVTTGEMVTNASRDYTVKIDARGLRAGQNYFYRFM
TGDKTSAVGKTRTLPEGDVSSVKLAVMSCANFPAGYFNVYELAAAQDDLDAVVHLGDYIY
EYARGGYASEHAAELGREVLPATELLTLGDYRTRYGQYHTDASLQKLHAKVPFITVWDDH
EVANDTWRDGAENHNEGEGDFAARKEAALQAYFEWLPIRPWREGNHEEIYRSFSYGNLVD
LHMLDTRVLARDKQLDYADYMDPTTGSFAGERFLADVTSTTRTMLGLTQLLWLQGTLLQA
TGKWQVLGQQILMGKMSLPAAIATQQMSIPQYAMLGALAKLAARAAANDPTLTAQELQYL
QANQALLTPEVIALLQLPAIPYNLDAWDGYAYEREVILGTAKSKNLNLVVIAGDTHNAWA
NELKDVNGDTVGVEFATSSVSSPGLEYYLNLPAEQIPATEAAIVELVPDLKYANLRDRGF
MTLTFTADEVRSDWHYVDTILSKDFQAATARGYSAKAKVGEHVITPIV
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtaccgtaactcgtcgtgactttttggctatgtcggccaaaggtgttggcgtt
gctgtgatctcttacggcttgatgggctgtagcgatagtaatgatgataattctgtacct
gcgcaatttttacatgggattgccagtggcgatcctgcgattgatgctgtgatcctttgg
acccgtgtcacgcctgagtctgagggcgatgtaaaagtgagctggcaagtggcaagcgat
gcggcctttagtcaattagtgaccacgggtgagatggttactaatgcaagccgtgactac
acggttaagattgatgcccgcggcttacgtgctggccaaaactacttttaccgctttatg
acaggtgacaaaacctcagccgtgggtaaaacccgtacgctgcctgagggcgatgtgagt
tctgtcaaactggcggtgatgtcctgtgcgaactttccagccggatactttaacgtatat
gaattagcggcggcgcaagatgacttagatgccgtggtgcatttaggcgattacatttat
gaatatgcccgcggcggttatgccagtgagcatgctgcagagcttggccgtgaagtctta
ccggccactgagttgctgacattaggcgattatcgcacccgttatggtcagtaccatacc
gatgcgagcctgcaaaagttacacgcgaaagtgccttttatcacagtttgggatgatcac
gaagtagccaacgatacttggcgtgatggcgccgagaatcataacgaaggcgaaggcgat
tttgccgcccgcaaagaagcggcactgcaagcctatttcgagtggctgcctattcgccca
tggcgcgaagggaaccatgaagagatttaccgcagcttcagttacggcaatcttgtcgac
ctgcacatgctcgatacccgtgtattggcccgtgataaacagctcgattatgccgattat
atggatccgacaacgggttcgtttgcgggcgagcgtttccttgccgatgtgacttcgacc
actcgcactatgctgggtctgacgcaattgttatggctgcagggcactctgctgcaagca
acgggcaagtggcaggtgttagggcaacagattttgatgggcaagatgtcattgccggcg
gcgattgcgactcagcagatgagcattccccaatatgccatgttaggtgcgttagctaag
ttagcagcgcgtgcggcggcaaatgatcccacactgaccgcccaagagttgcaatatctt
caggctaatcaagccttattaaccccagaagttatcgcactgctgcaattacctgccatt
ccatacaacttagatgcttgggacggttacgcctatgagcgtgaggtgattttaggtacg
gctaaatcgaaaaacctcaacctagtcgtgatcgcgggcgatacccataatgcctgggct
aacgagcttaaagatgtgaatggcgataccgttggggtggagtttgcgaccagctcagtg
tcttcaccaggtcttgagtactatttgaatctgcccgctgagcagatccctgcgactgag
gcggcgatcgtcgagttagtgccagatcttaagtacgctaacttaagagatcgcggcttt
atgacgctcactttcaccgctgatgaggtgcgcagcgactggcattatgtggataccatt
ctgtcgaaggatttccaagcggcaacggcacgtggctatagcgccaaggcaaaagtgggc
gagcatgtgattacgcctatcgtttaa

DBGET integrated database retrieval system