KEGG   Shewanella baltica OS155: Sbal_0972Help
Entry
Sbal_0972         CDS       T00478                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
sbl  Shewanella baltica OS155
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbl00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:sbl00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1114777..1115259
Genome map
AA seq 160 aa AA seqDB search
MRIAMIAAMANNRVIGKENKMPWHLPEDLRHFKGMTLGKPVLMGRKTFESIGRPLPGRHN
IVISRQTDLVIEGVTCVTSFDAAKQAAGECEELVVIGGGQLYAELLPYADTLYLTQIKLE
VEGDTFFPHWDDGTWKETESLSSINADGLEYRFINLVKKC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgctatgatagccgcgatggcaaacaatcgagtcatcggaaaagagaataaa
atgccatggcatcttccagaagatctacgtcactttaaaggcatgaccctaggtaagcct
gtgctgatggggcgtaagacctttgagtccattggtagaccccttcctggccgacataac
atagtgatttcacgtcaaacggatctcgtcattgaaggcgtgacctgtgtgacctctttt
gatgcagccaaacaagccgccggcgagtgtgaagagttagtagtgattggtggcggacag
ctttatgccgagttattaccttacgcagataccttatatttgacgcaaatcaagctagag
gttgagggcgatacatttttcccccattgggatgacggaacttggaaagaaacggaatct
ttgtctagtataaatgcggatggtttggaatatcgctttatcaatttggtaaaaaaatgt
taa

DBGET integrated database retrieval system