KEGG   Shewanella baltica OS155: Sbal_1046Help
Entry
Sbal_1046         CDS       T00478                                 

Definition
(GenBank) Phosphoketolase (EC:4.1.2.9)
  KO
K01621  
xylulose-5-phosphate/fructose-6-phosphate phosphoketolase [EC:4.1.2.9 4.1.2.22]
Organism
sbl  Shewanella baltica OS155
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Sbal_1046
Enzymes [BR:sbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.9  phosphoketolase
     Sbal_1046
    4.1.2.22  fructose-6-phosphate phosphoketolase
     Sbal_1046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1204351..1206717)
Genome map
AA seq 788 aa AA seqDB search
MTQIHEINALKKYVRATNFLATSQIYLKQNVLHKRPLAHTDIKPRLLGHWGTCPGINFVY
ANINRLIVKHNRSFIYLVGPGHGFPAVQANLFMEGSLSHFYPETIPYNETGIEDICKKFS
AAYGYPSHANPEAPGQILEGGELGYSLSVGWGAVLDNPDLIATVLIGDGEAETGPLAASW
YANRLVSPATSGAVLPIVHINGYKISGPTRMGRMSHEELDLEFRGLGYFPIIVDNELEED
IYVQMTNAMDTAYAMINDIQRRARSSEDVVKPKWPVILMRTAKGWTGVSEYKGKKLEGNC
ESHQVIVNKCATDKGHLDALDNWLASYNFQELYQMNDKGELIFDADICSLIPPKQLACGR
QHLTYGGEVVRALTNPDLEKLSYGPEVPRGHRGYSMLKMGEWMRDAFKLNRDQRNLRIFS
PDETYSNQLQAVFEETDRAWQWPIESWDEDMSREGRVIELLSENLLFGMLHGYTVTGRHG
MFPTYESFSQVISSMADQYCKYVYASQGVHFRKPLPSCNVVLSSLLERQDHNGYSHQNPS
FLGAMLEKHPKIISAYLPADANSTLVYTERAYADRDKLNILVAGKKELPQWLSLEEARKQ
AKDGVMVWDFASDENPDIVLAGCGDYVTQECMASLVLIRELLPRVKIRFVSVTELSSDGL
GSRKFKEKPWLMDEIFTQDKGVVFNYHGYPNTIKKLIFDYKGSRRFRIKGYEEEGSTTTP
FDMGVRNGTSRYHLVIDMAYKLFQQGVIDETMHVSITTDMLQRLVDHRNYIKANGVDPIE
IENWIWTR
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgacacaaatacatgaaatcaatgctctgaaaaaatatgtcagagcgactaactttctt
gcgacctcgcagatttatctcaaacaaaacgtcttacataaacgtccacttgcccatact
gatatcaaaccacgtttacttggccactggggtacctgccccggcattaactttgtttat
gccaacattaaccgattgatagtgaaacataatcgctcgttcatctatttagttggtcct
ggtcatggtttcccagcagtacaagctaacttattcatggaaggttcattaagtcatttc
tatccagaaacgatcccctacaatgaaaccggtatcgaagatatttgtaagaagttttcc
gccgcttatggctatccttcacatgcaaacccagaagctccaggacaaattcttgaaggt
ggcgaactaggctactcactttctgttggctggggtgcagtactcgataatccagatctg
atcgccaccgtcttaattggtgacggtgaagcagaaaccggaccattagccgcgtcttgg
tacgcaaaccgtctagtctctcctgcgacaagtggtgcagtattaccgattgtgcatatc
aatggctataaaatttcaggccctacccgcatgggacgcatgagtcatgaagaactggat
cttgaattccgtggtcttggctacttcccaattatcgttgataacgaattagaagaagat
atctatgtgcagatgacgaatgccatggataccgcttatgccatgatcaatgatatccaa
cgtcgtgcccgtagcagtgaagatgtagttaagcctaaatggccagtgattttaatgcgc
accgccaaaggttggaccggtgtcagtgagtataaaggtaagaaattagaaggtaactgt
gaatcacaccaagtgatcgtcaataaatgtgccacagataaaggtcatctggatgcactc
gacaattggcttgccagttacaacttccaagaactttaccaaatgaatgataaaggcgag
ctgatttttgatgccgacatttgctcattaattccacctaagcaacttgcctgtggtcgt
caacatctcacctatggtggtgaagtggttagagcgttaacgaaccctgatctcgaaaaa
ctcagctacggtccagaagtaccacgtggtcaccgtggttattcaatgttgaaaatgggt
gaatggatgcgtgatgcattcaagctaaaccgcgatcaacgcaatctacgtatttttagc
cctgacgaaacctattcaaatcaactacaagccgtatttgaagaaaccgatcgtgcatgg
caatggccaattgagagctgggatgaagacatgtcccgcgaaggacgagtgattgagctc
ctttctgaaaacttgctctttggtatgttgcacggctacacagtaacaggccgccacggc
atgttccctacgtatgaatcattctcacaagtgatctcatcgatggccgaccaatactgt
aaatacgtctatgcaagccaaggcgtgcatttccgtaagccactgccttcatgtaacgtc
gtattatcttcgctgcttgaacgccaagaccataatggctactcgcatcaaaacccgtct
ttccttggggctatgctagagaagcatccaaaaattatctctgcttatttaccagcagat
gctaacagcaccttggtttataccgaacgggcttacgccgaccgcgacaaactcaatatt
cttgttgctggtaagaaagagttaccacaatggttgagcttggaagaagcgcgtaaacaa
gcaaaagatggcgtgatggtgtgggatttcgcctctgatgagaatccagatattgtgctg
gcaggttgtggtgattacgtcactcaagagtgcatggcctcattagtattgatcagagaa
ctccttccaagagtcaaaattcgcttcgttagcgtcaccgaattaagcagtgatggctta
ggaagccgcaaatttaaagaaaaaccttggttaatggacgaaatatttacccaagataaa
ggcgtggtattcaattaccatggttacccaaatacgattaaaaagttaatatttgattac
aaaggcagccgtcgcttcagaattaaaggctatgaagaagaaggttcaacaaccactcca
ttcgatatgggcgttcgtaacggcacatcacgttatcacctagtgattgatatggcttac
aaactgttccaacagggcgttattgatgaaactatgcacgtttccatcaccactgacatg
ctgcaaagactagttgaccaccgcaactatattaaagcgaatggtgtcgacccaatagaa
attgagaattggatatggacacgttaa

DBGET integrated database retrieval system