KEGG   Shewanella baltica OS155: Sbal_1229Help
Entry
Sbal_1229         CDS       T00478                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbl  Shewanella baltica OS155
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal_1229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal_1229
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Sbal_1229
Enzymes [BR:sbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Sbal_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1413249..1414532
Genome map
AA seq 427 aa AA seqDB search
MELYNLKHPSQKVSFKEAVQLGLGQDRGLFFPTQIPVLDDIEGLLALPFVERSKKVLGAW
LASELGQDAVDELVERAFNFDLPLVAVDEQRACLELFHGPTLAFKDFGARFMAQCVNAFV
GDTRLTILTATSGDTGAAVADAFYGLEKVNVVVLYPKGKISELQEKMFTTLGKNIHTVAV
SSDFDACQDLVKRAFDDPEVREGLSLNSANSINISRLLAQICYYFEAVAQSKQRHDADPV
ISVPSGNFGNLTAGLFAKAMGLPVKRFIAATNANDTVPRYLENGQWQPNQTQATMSNAMD
VSEPSNWPRVEAICEKLAWPLSNLVGMRLSEEQTSLALAELHAQGYVSEPHAAIAAKALS
LTLVPDEVGIFLGTAHPAKFKDVVDRELNLNLPLPVELEAVAHKPILSADLPADFAALKA
HLFKILT
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atggaactatataatttaaaacacccttcgcagaaagtgagctttaaagaggcagtgcaa
ttaggtttaggtcaggatagaggtttgttcttccccacccaaattccggtcttagacgat
attgaaggactgctggcattgccatttgttgagcgcagtaaaaaagtgctcggtgcatgg
cttgcctctgaactagggcaagatgcagttgatgaactggttgaacgtgcctttaacttc
gatttacctttggttgccgtcgatgagcagcgcgcttgcctcgaattgttccacggtcct
actctggcatttaaagattttggtgcgcgttttatggcgcaatgcgtcaatgcctttgtc
ggcgacacacgcttaaccattctgactgcgacttcgggtgacactggcgccgcggttgcc
gatgccttttatgggcttgaaaaagtcaatgtagtggtgctctatcctaagggcaagatc
agtgagctacaggaaaagatgttcacgactttgggcaagaatatccatacagttgccgta
tcgtccgattttgatgcctgccaagatctggttaaacgcgcctttgatgatccagaagtc
cgcgagggtttgagcttaaactcggcgaactctatcaacatcagccgcttacttgcgcaa
atttgttattactttgaagccgttgcccagtctaaacaacgccacgacgccgatcctgtg
atttcagtgccaagtggtaactttggtaacctgacggcgggtttattcgccaaagccatg
gggttaccggttaaacgctttatcgccgcaaccaatgcgaatgatactgtgccgcgctat
ttagaaaacggccaatggcagcccaatcaaacccaagcgaccatgtctaatgcgatggat
gtgagtgagccaagtaactggccgcgagtggaagccatttgtgagaaattagcttggccg
ctgagtaacttagtgggcatgcgtttatctgaagagcaaacttcactggcattagctgag
ttgcatgcacagggttatgtgtctgagccccatgcagcgattgcagctaaagctttgtct
ttaaccttagtgcccgatgaagtgggtatattcttaggtacagcgcatcccgctaaattt
aaggatgtggtcgatagagagctaaatcttaacttaccactgccggttgaacttgaggcc
gttgcccacaaacctatcttgtcggctgacttacccgccgattttgcggcactgaaagcg
cacttattcaagatcttaacctaa

DBGET integrated database retrieval system