KEGG   Shewanella baltica OS155: Sbal_1293Help
Entry
Sbal_1293         CDS       T00478                                 

Definition
glycoside hydrolase
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
sbl  Shewanella baltica OS155
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1476243..1476734
Genome map
AA seq 163 aa AA seqDB search
MNKFKQSLLAMGLSGVLLTGGVLVAQQEGLVLGTYVDPVGIVTACFGKTGPEFELGQRFS
EQECLAMLADDLEVFDRQLTNQVRVPITDSERAAYLSFMYNVGAQNFSDSTLRKKLLHGD
RIGACNELSRWVYAKGKKLQGLVNRREAERQLCLKELKHVSNH
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattcaagcagtcgttattagccatgggattgtcaggcgtattactcactggc
ggcgtactcgtcgctcagcaagaggggctagtgcttgggacttacgttgaccctgttgga
attgtaacggcctgcttcggtaagactgggcctgagttcgagctagggcagcgctttagc
gagcaagaatgtctggcgatgttagctgatgatttagaagtattcgatcgccaattaacg
aatcaagtacgtgtgcctatcaccgatagcgaacgcgctgcttacctcagttttatgtac
aacgttggcgcacagaactttagtgattcaacactgcgaaaaaagttactgcatggcgac
cgtattggcgcgtgcaatgagctaagccgctgggtttatgccaaaggcaagaaactccaa
gggcttgttaaccgccgtgaagctgaacggcaactttgtttaaaggaactaaagcatgtt
tcaaaccattaa

DBGET integrated database retrieval system