KEGG   Shewanella baltica OS155: Sbal_1316Help
Entry
Sbal_1316         CDS       T00478                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbl  Shewanella baltica OS155
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal_1316
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal_1316
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal_1316
Enzymes [BR:sbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1498349..1499998
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTLGKATANATLNIVGRDIPGQEVIFTEGAVALLESLCREFADEVPAL
LAKRKDKQARIDKGSLPDFLPETRAIRDGAWQIRGIPDDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWEKVVEGQINLRDAVRGDIEYTAPDTGKHYKLGPNPAVLICR
VRGLHLKEKHVQFNGKAISGSLFDFALYFYHNYRQLLAKGSGPYFYIPKLESHVEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPVQNEAVL
QRVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHCNQLHITRDVDAPILASEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELSNVKKEVGSDRFTHGKFTQAAVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttgagtgaacagcaattgaattcgacactgggtaaagctacagca
aacgccacccttaatattgtgggtcgtgacattccaggccaagaagtcatctttaccgaa
ggggctgtcgccttactcgaatccctttgtcgtgaatttgccgacgaagtacctgcctta
ctcgctaaacgtaaagataagcaagcgcgtatcgataaaggatcattacccgactttctg
cctgaaacccgcgctatccgtgatggtgcatggcaaattcgtggaattcccgatgacttg
cttgaccgccgcgtggaaatcacaggtcccgttgaacgtaagatggtgattaatgcactc
aacgccaatgccaaagtgtttatggccgatttcgaagattctttagcaccaagctgggaa
aaagtcgtcgaaggtcaaatcaatctacgtgatgccgtgcgtggtgatattgagtacaca
gcaccggacacgggtaagcactacaaattaggaccaaatcccgcagtgcttatttgccgc
gttcgtggtctgcaccttaaagaaaaacacgtgcagtttaacggcaaagcgatttcaggc
tcactgtttgatttcgcactgtatttctaccacaactatcgccaacttttggccaagggc
agtggtccatacttttatattcctaagttagaaagtcatgttgaagcgcgctggtgggca
aaagtatttgcttttgttgaggaaaggttttgtctgcaagcgggcacgattaaatgtact
tgcctgatcgagacgttaccggccgtgttcgaaatggacgaaatcctctatgagctgcgt
tccaatatcgtcgcgctgaactgtggtcgctgggattacatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgagtcttaccggatcgccaagccgtcactatggatacgcct
ttcttaagcgcttattcaagactcttgattaagacctgccacaaacgcggtgcgttagcg
atgggcggcatggcggcctttattccagccaaagatccggttcagaacgaagcggtattg
caacgagttcgtcgagataaagaactggaggcgcgtaacggccacgatggcacttgggtg
gcacaccctggtcttgccgataccgctatgggtattttcaacgaatacataggccaagat
cactgtaatcaattgcatattacccgtgatgtcgatgcgccaatcctggctagcgaactg
cttaaaacctgcgatggtgagcgcaccgaacaggggatgcgtctgaacattcgtatcgca
ctgcagtatttagaggcgtggatcagcggcaacggttgcgtacctatttacggcttaatg
gaagatgcagctacggctgagatttctagagcttcaatttggcaatggatccaacacggt
aagtcgctgtcaaacggcaaactcgtgaccaagcaactttttaaagacatgttggttgaa
gagctgtcgaacgtgaaaaaagaagtgggtagcgacagattcacccatggcaaattcacc
caagcggcggtattgctcgaagacattaccacctccgacgagctggtcgatttcttaacc
ttacccggttacgaaatgctgactgcctag

DBGET integrated database retrieval system