KEGG   Shewanella baltica OS155: Sbal_1316Help
Entry
Sbal_1316         CDS       T00478                                 

Definition
malate synthase (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbl  Shewanella baltica OS155
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal_1316
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Sbal_1316
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal_1316
Enzymes [BR:sbl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Sbal_1316
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1498349..1499998
Genome map
AA seq 549 aa AA seqDB search
MTEHTLSEQQLNSTLGKATANATLNIVGRDIPGQEVIFTEGAVALLESLCREFADEVPAL
LAKRKDKQARIDKGSLPDFLPETRAIRDGAWQIRGIPDDLLDRRVEITGPVERKMVINAL
NANAKVFMADFEDSLAPSWEKVVEGQINLRDAVRGDIEYTAPDTGKHYKLGPNPAVLICR
VRGLHLKEKHVQFNGKAISGSLFDFALYFYHNYRQLLAKGSGPYFYIPKLESHVEARWWA
KVFAFVEERFCLQAGTIKCTCLIETLPAVFEMDEILYELRSNIVALNCGRWDYIFSYIKT
LKRHSDRVLPDRQAVTMDTPFLSAYSRLLIKTCHKRGALAMGGMAAFIPAKDPVQNEAVL
QRVRRDKELEARNGHDGTWVAHPGLADTAMGIFNEYIGQDHCNQLHITRDVDAPILASEL
LKTCDGERTEQGMRLNIRIALQYLEAWISGNGCVPIYGLMEDAATAEISRASIWQWIQHG
KSLSNGKLVTKQLFKDMLVEELSNVKKEVGSDRFTHGKFTQAAVLLEDITTSDELVDFLT
LPGYEMLTA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacacactttgagtgaacagcaattgaattcgacactgggtaaagctacagca
aacgccacccttaatattgtgggtcgtgacattccaggccaagaagtcatctttaccgaa
ggggctgtcgccttactcgaatccctttgtcgtgaatttgccgacgaagtacctgcctta
ctcgctaaacgtaaagataagcaagcgcgtatcgataaaggatcattacccgactttctg
cctgaaacccgcgctatccgtgatggtgcatggcaaattcgtggaattcccgatgacttg
cttgaccgccgcgtggaaatcacaggtcccgttgaacgtaagatggtgattaatgcactc
aacgccaatgccaaagtgtttatggccgatttcgaagattctttagcaccaagctgggaa
aaagtcgtcgaaggtcaaatcaatctacgtgatgccgtgcgtggtgatattgagtacaca
gcaccggacacgggtaagcactacaaattaggaccaaatcccgcagtgcttatttgccgc
gttcgtggtctgcaccttaaagaaaaacacgtgcagtttaacggcaaagcgatttcaggc
tcactgtttgatttcgcactgtatttctaccacaactatcgccaacttttggccaagggc
agtggtccatacttttatattcctaagttagaaagtcatgttgaagcgcgctggtgggca
aaagtatttgcttttgttgaggaaaggttttgtctgcaagcgggcacgattaaatgtact
tgcctgatcgagacgttaccggccgtgttcgaaatggacgaaatcctctatgagctgcgt
tccaatatcgtcgcgctgaactgtggtcgctgggattacatcttcagctatatcaaaaca
ttaaagcgtcatagcgaccgagtcttaccggatcgccaagccgtcactatggatacgcct
ttcttaagcgcttattcaagactcttgattaagacctgccacaaacgcggtgcgttagcg
atgggcggcatggcggcctttattccagccaaagatccggttcagaacgaagcggtattg
caacgagttcgtcgagataaagaactggaggcgcgtaacggccacgatggcacttgggtg
gcacaccctggtcttgccgataccgctatgggtattttcaacgaatacataggccaagat
cactgtaatcaattgcatattacccgtgatgtcgatgcgccaatcctggctagcgaactg
cttaaaacctgcgatggtgagcgcaccgaacaggggatgcgtctgaacattcgtatcgca
ctgcagtatttagaggcgtggatcagcggcaacggttgcgtacctatttacggcttaatg
gaagatgcagctacggctgagatttctagagcttcaatttggcaatggatccaacacggt
aagtcgctgtcaaacggcaaactcgtgaccaagcaactttttaaagacatgttggttgaa
gagctgtcgaacgtgaaaaaagaagtgggtagcgacagattcacccatggcaaattcacc
caagcggcggtattgctcgaagacattaccacctccgacgagctggtcgatttcttaacc
ttacccggttacgaaatgctgactgcctag

DBGET integrated database retrieval system