KEGG   Shewanella baltica OS155: Sbal_1317Help
Entry
Sbal_1317         CDS       T00478                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00630  Glyoxylate and dicarboxylate metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01120  Microbial metabolism in diverse environments
sbl01200  Carbon metabolism
Module
sbl_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Sbal_1317
Enzymes [BR:sbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Sbal_1317
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABN60835
JGI: Sbal1317
UniProt: A3D272
Position
1500139..1501464
Genome map
AA seq 441 aa AA seqDB search
MTKATTQNSRQEQIDAIKRDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKL
WELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYP
ANSVPAVVSRINNSFRRADQIQWGNGVNPEDEKFVDYFLPIIADAEAGFGGVLNAFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIART
DANAADLLTSDCDPYDRDFVTGERTNEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKP
DLEEARVFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLA
GIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTT
VIQGGHSSVTALTGSTEEEQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacgactcagaattcacgtcaagagcagattgatgcaatcaagagagat
tgggcagaaaacccacgttggaaaaacgtgcgtcgtccttacaccgcggaagaagtggtt
gcacttcgcggttcaatcgtgcctgagaatactattgccaagcgtggtgcggctaagtta
tgggaactggttaacggcggcgctaaaaaaggctatgtgaattcgctcggtgcgttaacg
ggcggtcaagcggtacaacaggcgaaagcgggtatcgaagcgatttacctttctggttgg
caagtggctgcagatgctaacttagccggcactatgtacccagatcaatctttataccca
gcgaactcagtgccagctgtggtatcccgtatcaataactctttccgccgtgctgaccaa
attcaatggggcaatggcgttaatccagaagatgaaaaatttgttgattacttcctgccg
attattgctgatgcagaagcgggttttggtggcgtattaaatgccttcgaactgatgaag
tcgatgatcgatgcgggcgctgccggcgttcactttgaagatcagttagcttcagtgaag
aaatgtggtcacatgggcggcaaagtattagtgccaacccaagaagcggtacaaaagctg
gttgctgcacgtttagcggcggatgtgagcggtgtggatacactggttatcgcccgtacc
gatgctaacgcggccgatttgttaacttcagattgcgacccatacgaccgtgatttcgtg
actggcgagcgtactaatgaaggtttctaccgtgttaaagcgggtcttgaccaagcgatt
tctcgcggtcttgcctatgccccgtatgcggatttgatttggtgtgaaaccgctaaaccg
gatcttgaagaagcgcgtgtttttgctgaagcgattcatgctcagtacccagatcaactg
ttagcgtataactgttcgccttcgttcaactggaagaaaaatctggacgacgccactatc
gcgcgcttccaacaagcattgtcagacatgggctacaagtaccagttcatcactttagcc
ggcatccacaacatgtggtacaacatgttcgacctcgcttacgactatgctcgtggcgaa
ggcatgaagcattatgttgagaaagttcaagaagttgagtttgctgcagcgaagaaaggt
tacaccttcgtcgcgcatcaacaggaagtgggcacaggttattttgaccaagtgactacg
gttattcaaggtggccattcatcagtgaccgcactgacaggttctaccgaagaagagcag
ttttaa

DBGET integrated database retrieval system