KEGG   Shewanella baltica OS155: Sbal_1317Help
Entry
Sbal_1317         CDS       T00478                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sbl  Shewanella baltica OS155
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:sbl01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sbl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1500139..1501464
Genome map
AA seq 441 aa AA seqDB search
MTKATTQNSRQEQIDAIKRDWAENPRWKNVRRPYTAEEVVALRGSIVPENTIAKRGAAKL
WELVNGGAKKGYVNSLGALTGGQAVQQAKAGIEAIYLSGWQVAADANLAGTMYPDQSLYP
ANSVPAVVSRINNSFRRADQIQWGNGVNPEDEKFVDYFLPIIADAEAGFGGVLNAFELMK
SMIDAGAAGVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVSGVDTLVIART
DANAADLLTSDCDPYDRDFVTGERTNEGFYRVKAGLDQAISRGLAYAPYADLIWCETAKP
DLEEARVFAEAIHAQYPDQLLAYNCSPSFNWKKNLDDATIARFQQALSDMGYKYQFITLA
GIHNMWYNMFDLAYDYARGEGMKHYVEKVQEVEFAAAKKGYTFVAHQQEVGTGYFDQVTT
VIQGGHSSVTALTGSTEEEQF
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggcaacgactcagaattcacgtcaagagcagattgatgcaatcaagagagat
tgggcagaaaacccacgttggaaaaacgtgcgtcgtccttacaccgcggaagaagtggtt
gcacttcgcggttcaatcgtgcctgagaatactattgccaagcgtggtgcggctaagtta
tgggaactggttaacggcggcgctaaaaaaggctatgtgaattcgctcggtgcgttaacg
ggcggtcaagcggtacaacaggcgaaagcgggtatcgaagcgatttacctttctggttgg
caagtggctgcagatgctaacttagccggcactatgtacccagatcaatctttataccca
gcgaactcagtgccagctgtggtatcccgtatcaataactctttccgccgtgctgaccaa
attcaatggggcaatggcgttaatccagaagatgaaaaatttgttgattacttcctgccg
attattgctgatgcagaagcgggttttggtggcgtattaaatgccttcgaactgatgaag
tcgatgatcgatgcgggcgctgccggcgttcactttgaagatcagttagcttcagtgaag
aaatgtggtcacatgggcggcaaagtattagtgccaacccaagaagcggtacaaaagctg
gttgctgcacgtttagcggcggatgtgagcggtgtggatacactggttatcgcccgtacc
gatgctaacgcggccgatttgttaacttcagattgcgacccatacgaccgtgatttcgtg
actggcgagcgtactaatgaaggtttctaccgtgttaaagcgggtcttgaccaagcgatt
tctcgcggtcttgcctatgccccgtatgcggatttgatttggtgtgaaaccgctaaaccg
gatcttgaagaagcgcgtgtttttgctgaagcgattcatgctcagtacccagatcaactg
ttagcgtataactgttcgccttcgttcaactggaagaaaaatctggacgacgccactatc
gcgcgcttccaacaagcattgtcagacatgggctacaagtaccagttcatcactttagcc
ggcatccacaacatgtggtacaacatgttcgacctcgcttacgactatgctcgtggcgaa
ggcatgaagcattatgttgagaaagttcaagaagttgagtttgctgcagcgaagaaaggt
tacaccttcgtcgcgcatcaacaggaagtgggcacaggttattttgaccaagtgactacg
gttattcaaggtggccattcatcagtgaccgcactgacaggttctaccgaagaagagcag
ttttaa

DBGET integrated database retrieval system