KEGG   Shewanella baltica OS155: Sbal_1331Help
Entry
Sbal_1331         CDS       T00478                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbl  Shewanella baltica OS155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal_1331
Enzymes [BR:sbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Sbal_1331
Exosome [BR:sbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal_1331
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1517811..1520042
Genome map
AA seq 743 aa AA seqDB search
MMTQANAYFYDGADVALLNGQYTDVFSLLGMHSANEGKALIVRCFLRNAISVDVISIKDG
RKVASLDKVNEQGLFAGTLGRRVKPFLYLLRVEYPLCQLDIVDPYQFDSLLNSDDIYLFG
EGSAERAYEFLGANWRQTQGVEGVHFCVWAPNAKRVSVVGDFNHWDDTRHVMRQHLANGL
WELFLPNVVEGAHYKFDLVYQNGERHTKSDPMATQMECAPHNASIVPPKAHHSWNDTAWM
SKRAATAWHKAPMSAYEVHLGSWRRKGEQGEQYLDYQDLIEQLIPYVKEQGFTHIELMPI
SEFPFDGSWGYQPVGLYAPTHRFGDANGLKAFVDACHQAGIGIILDWVSAHFPKDPHGLV
RFDGTCLYEHEDPRKGTHPDWDTLIYNYDRGEVRSFLLSNACYWLREFHFDGLRLDAVSS
MLYLDYSREPGQWLPNAYGGRENLEAISFLQILNQRLYQAFPGICMIAEESTAFAGVTKP
TDQQGLGFGFKWNMGWMNDSLSYLGRDPLYRQFHHHQLTFSLMYAYTEQFMLSVSHDEVV
HGKGSLLHKIPGDDWQKFATLRAYYGFMWGHPGKKLLFMGCEFGQRNEWNHNQSLDWHLL
AYEPHQGVQRWLKDLNHLYQAMPALSVQDYEGAGFSWLDCENSRDSIFTFVRYGLAGDAP
LVFVINMTPQLHTGFRIGLPLAGDYREYLNSDSQIYGGSNQGNAGTVVAESLPWQGMAQS
ALITVPPLGCLVIGPATGLAEAN
NT seq 2232 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcaagccaatgcctatttctacgatggcgccgacgtcgccctacttaatggt
caatacactgatgttttttcgctcttgggtatgcacagtgccaacgagggtaaggcatta
attgttcgttgttttttacgtaatgcaatcagtgtggatgtgatcagcattaaagatggc
cgcaaagtagcgagtctagacaaagtcaacgagcagggattgttcgccggtacgctgggg
cgacgcgtcaaaccgtttctctatttgctacgggtagaatatcccttgtgtcagttagat
atagtcgacccttatcagtttgattcattgcttaatagtgacgatatttacctgtttggt
gaaggcagcgccgagcgcgcctatgagtttttaggcgccaactggcgtcaaacccaaggc
gttgaaggtgtgcatttttgtgtgtgggcacccaatgccaaacgggtttctgtggtgggg
gatttcaaccattgggacgatactcgccatgtaatgcgccaacatcttgccaatggtttg
tgggagctatttctgcccaatgtggttgaaggcgcccactataagtttgatttggtttat
caaaatggtgagcgtcataccaagtccgaccccatggcgacccaaatggaatgcgcgccc
cataatgcttctatcgtgcccccaaaagcccatcacagttggaatgataccgcttggatg
agtaagcgagcggcgactgcttggcataaagcgcccatgtcggcctacgaagtgcactta
ggttcgtggcgtcgtaagggagagcaaggcgagcaatatcttgattatcaagacttgatt
gaacagcttattccctatgtgaaggagcaaggttttacccacattgaactgatgccgatc
agcgagtttcccttcgatggttcgtggggatatcagcctgtgggtctctatgcaccgacc
cacagatttggcgatgccaatgggttaaaagcctttgtggatgcctgccatcaggcggga
attggtatcatcctcgattgggtgtcggcgcattttcctaaggatccccacggcttagtg
cgtttcgatggcacttgtttgtatgagcacgaagatcctcgcaagggcacacatcccgat
tgggataccctgatttataactatgatcgcggtgaagtgcgcagtttcttgttgagtaat
gcctgttactggctgcgggagtttcattttgatggcctgcgtctcgatgccgtgtcttct
atgttgtacctcgattacagccgcgagccgggccaatggctgcccaatgcctatggtgga
cgggagaatctcgaagccattagtttcttacaaattttgaatcaacgcctgtaccaagct
ttccccggcatttgcatgattgccgaagagtccaccgcctttgcgggggtgactaagccg
acggatcagcaaggtctcggctttggctttaaatggaacatgggctggatgaatgacagc
ttaagctacttaggccgagatccgctttaccgccaattccaccatcatcaattgaccttc
agtttgatgtacgcctataccgagcaatttatgttgtccgtgagtcacgatgaagtggtc
cacggcaagggctcgttgctacataaaattcccggtgacgattggcagaaatttgcgacc
ctgcgtgcttattacggttttatgtgggggcatcccggtaagaaattactctttatgggc
tgcgagtttggtcagcgaaatgagtggaaccataaccagagtttagattggcacttattg
gcttatgaaccgcaccaaggtgtgcaacgttggcttaaagatctcaatcacttgtatcaa
gccatgcctgctttatcagttcaggattacgagggggcaggattcagttggctagattgt
gaaaatagccgcgacagcatctttacctttgtgcgttacggcttagcgggtgatgcgccg
ttagtgtttgtcatcaacatgacgccccaattgcacactgggttccgtattggtttgccc
ttggcgggggattaccgcgaatacctgaatagcgatagccagatttatggtggcagtaac
caaggtaatgcgggcactgtcgttgctgagtcgctgccgtggcagggcatggcgcagagc
gcgctgatcactgtgccgcccttgggttgtctagtgattgggcctgcaactggattggct
gaggcgaactag

DBGET integrated database retrieval system