KEGG   Shewanella baltica OS155: Sbal_1405Help
Entry
Sbal_1405         CDS       T00478                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbl  Shewanella baltica OS155
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal_1405
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Sbal_1405
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Sbal_1405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1616297..1619029)
Genome map
AA seq 910 aa AA seqDB search
MKGLIKKKGKIKWQRIKTALVSGIMAVLPAMPVLSILVMPSVQAANAVQEANHVALNQLA
DKLQLNYQLTASYLETCPAKETQCYRSAIELTLPTQLSNEELNHGDWQIYFSQLSPVYFV
DAGDFNIEHINGDLHKIVPKASFKGFVANQFYRIEFYSQGSQITRSEFMPNFFVAMGDKA
QLIKSTQTQRNKETGLPEQAYLAPFNADQQFLLAKNDATPFADGQYLAEQYQALAANANK
ATDISDKLIPTPLHSQSLDSAPLSLAKGYRLTADAVDFKGRQAAFDYLASLGFAAKDKGT
PLLLQLDTQAPKVASTEAHDSEMKTSEAYQLTITAEQISIRAGTEAGLFYGLQSLAGLIS
LSDDQLVAIEIQDQPRYAFRGLHIDLARNFHSLDFIKRIIPQLAAYKINKLHLHLADDEG
WRLAIPGLPELTDVGAKRCFDLTEQSCLLPQLGSGIADVKPVDGYLTVAQYQEILQLADA
HHIEVIPSLDMPGHSRAAIKSMEARYHNYLAKGDKAKAEEFLLTEFADKTQYSSLQYYHD
NTLNVCLASTYHFIDTVIDEVKKMHQAVGIPLVHYHIGADETAGAWVDSPACITMKKQKA
DELTGLHSLNGYFIERVANMLADKGIIAAGWNDGMGEVRPENMPAQVQSNAWSLISDNGH
QIAHKQVNLGWKVVLSTPEVTYFDFPYASHPDERGNHWAARAIDSFKVFSFMPDNLPAHA
ERWRNSLNQPFIADDSHSQLKPGHRFYGLQGHLWSEMVQSDEQAEYMLFPRMIALAERAW
HKASWELAYDYQGKIYSQQTQHFASQLNGQAEQVLKQDWQTFAAVYANKVQPKLAKAGVF
YRIAPPGIRIENQLLVLNSLYPNAELEYQLDSGPWLTYRQAFKLNDVKHIRARVKDGTRY
SRPSTWQSSL
NT seq 2733 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggactaataaaaaagaaagggaaaataaagtggcagaggattaagacggcctta
gtcagcggcataatggccgtgcttcccgcgatgcctgtgctttcaatacttgttatgcca
tcagtacaggcagccaacgccgtgcaggaggcaaatcatgtcgcacttaatcaattggcc
gataagctccaattaaattatcagttaaccgccagttatcttgaaacctgtcccgctaaa
gaaacccagtgctatcgctccgccattgagctaaccctgcccactcagttatctaatgaa
gagttaaatcacggcgactggcaaatttatttcagccaattatcgcctgtttatttcgtc
gatgcgggtgactttaacattgagcatatcaatggcgatttacacaaaatcgtccctaaa
gccagctttaagggcttcgtcgccaatcagttttatcgtattgagttttatagccaaggc
agccaaatcacccgttccgagtttatgccaaacttcttcgtcgctatgggtgataaagcg
cagctcataaagagcactcaaacccagcgcaataaagagacggggttgcccgagcaagcc
tacctcgcgccttttaatgccgatcaacaattcttactggcaaaaaacgatgcaaccccc
tttgccgatggccagtatttagccgagcaatatcaagccttagccgcaaacgcaaacaag
gcaactgacattagcgacaaactcatccccacgccacttcacagccaaagcctagactca
gcgcccttatctcttgccaaaggttatcgactcacggctgatgcggtagactttaaagga
cggcaggcggcgtttgattacctcgccagtttagggtttgcagccaaggacaaaggcacg
ccgctgttattgcaactcgatactcaagcccctaaagtcgccagcactgaagcccatgat
agtgaaatgaaaaccagcgaagcctatcagttaaccataacggctgagcaaatcagtatt
cgagcgggcactgaagcgggactcttctatggcctacaaagcctagcagggttgatcagt
ttaagtgacgatcaactggtcgccatcgagatccaagaccagcctcgctacgcctttcgc
ggcctgcacatcgatttagcccgtaacttccactcgctagattttattaaacgcatcatt
ccacaactcgccgcctataaaatcaataagctgcatttgcacttagccgacgatgaaggc
tggcgtttagccatccccggcttacccgaactgaccgatgtgggcgcaaaacgctgtttc
gatttaaccgagcaaagctgtttattgccacaactgggcagcggaattgcggacgtaaaa
cccgtcgatggctacttaaccgtggcgcaataccaagaaatattacaactggctgatgct
caccatatcgaagtgatcccttcactggacatgcctgggcattcacgcgcagcgataaaa
tccatggaggcgcgttatcacaattacctcgccaagggagacaaagctaaggcggaggag
tttttactgactgaatttgcagataaaacccaatattcgtcgcttcagtattatcacgac
aacacactcaatgtgtgcttggcgagcacctatcactttatcgatactgtgattgatgaa
gttaaaaaaatgcaccaagccgtaggcattcccttagtgcattaccacataggcgccgat
gaaaccgcgggcgcttgggtcgactctcccgcgtgtatcacaatgaaaaaacaaaaagcc
gatgagttaaccggactccactcactcaatggctactttatcgaacgcgttgctaacatg
ctggcagataaagggattattgctgctggctggaatgatggtatgggtgaagtgcgcccc
gaaaacatgcccgcccaagtgcaatctaacgcttggtcactgatttcggacaacggccat
caaatcgcccataagcaagtcaatcttggctggaaggtcgtgctctcaacgccggaagtc
acctattttgattttccctatgctagccatccagatgagcgcggtaatcattgggcagca
agggcaattgacagttttaaggtgtttagctttatgcccgacaacctgcccgcccatgcc
gagcgctggcgcaatagtttaaatcagccatttattgcggacgacagccacagccagctc
aagccgggacacagattttacggcttgcaggggcatctttggagcgaaatggtgcaatcg
gatgagcaagcagaatacatgctattcccgcgcatgatagcccttgcagaacgggcttgg
cacaaggcatcgtgggaattagcctatgattatcaaggtaaaatctatagccaacagact
caacattttgccagccaactcaatggccaagccgagcaagtcctcaaacaggattggcaa
accttcgccgcagtgtacgccaataaagtgcaacctaagttagcaaaagcgggagttttc
taccgcatagcgccaccaggaatacgtattgaaaatcagctgttagtgctcaatagcctg
tatcccaatgccgagctggaataccaactcgactcaggaccttggctaacctaccgccaa
gcattcaagcttaatgatgtcaaacacatccgcgccagagtcaaagatggtacgcgttac
tctcgcccatcgacttggcaaagctcactctaa

DBGET integrated database retrieval system