KEGG   Shewanella baltica OS155: Sbal_1406Help
Entry
Sbal_1406         CDS       T00478                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbl  Shewanella baltica OS155
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal_1406
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Sbal_1406
   00052 Galactose metabolism
    Sbal_1406
   00500 Starch and sucrose metabolism
    Sbal_1406
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal_1406
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Sbal_1406
   00524 Butirosin and neomycin biosynthesis
    Sbal_1406
Enzymes [BR:sbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Sbal_1406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1619173..1620021)
Genome map
AA seq 282 aa AA seqDB search
MSVLCLDLGGTKLMLAQVEGKTLLDTWRYPVPADGNFEQLFDFLVTCIHSHLTPETYGIS
IGIPGMVDMQSGTLLEVLNIPALTATQLAQQLKNTFEMDVVVNNDANLFALGEAVLNSNQ
DMLGITLGTGVGAGVIFNGQLYSGKHCAAGEIGSLSYRDGIIEHYCSGQYFTTHHHMSGE
HLYQKACEGDSQALQAFAHFGEHLAHMIAQTLLVYDPKDIVLGGSVSQSFPFFIEALKQK
LQSLVYGPQLADLTISASQHHNAALIGAAQWFLQQQKSSDFN
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcgtcctatgtttagatcttgggggaactaaactgatgttggcacaggtggaaggt
aaaaccttactcgacacttggcggtatcccgttcccgccgatggcaatttcgaacagtta
ttcgatttcctcgtgacctgtatccacagccatctcacgcctgaaacctatggtatttcc
atcgggatacccggcatggtggatatgcaaagcggcactttactcgaagtgctcaacatc
cctgcgttgacggcaacgcagttagcccagcaacttaaaaatacctttgaaatggatgtt
gttgtgaataacgatgcgaacctctttgcccttggcgaagctgtgctcaacagtaatcaa
gacatgctcgggattaccttaggcactggcgtgggcgctggggtgatttttaatggtcag
ttgtattcgggtaaacattgcgccgcaggagaaatcggcagtttgagctatcgcgatggc
attattgagcactactgctcggggcaatacttcaccactcaccatcatatgagtggcgaa
catttgtaccaaaaagcctgtgaaggtgacagccaagcgctgcaagccttcgcccatttt
ggtgaacacttggcgcacatgatcgcccaaaccttactggtatacgatcccaaagatatc
gtccttggcggctcagtcagccaaagctttcccttttttattgaagcgcttaaacagaaa
ttgcaaagcttagtctatggcccccaactggcggacttgacgatttcagccagccaacat
cacaatgcggcactcataggcgccgcgcaatggtttttacaacaacagaaatcaagcgat
tttaactaa

DBGET integrated database retrieval system