KEGG   Shewanella baltica OS155: Sbal_1483Help
Entry
Sbal_1483         CDS       T00478                                 

Definition
(GenBank) UDP-glucose pyrophosphorylase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00040  Pentose and glucuronate interconversions
sbl00052  Galactose metabolism
sbl00500  Starch and sucrose metabolism
sbl00520  Amino sugar and nucleotide sugar metabolism
sbl01100  Metabolic pathways
sbl01130  Biosynthesis of antibiotics
Module
sbl_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Sbal_1483
   00052 Galactose metabolism
    Sbal_1483
   00500 Starch and sucrose metabolism
    Sbal_1483
   00520 Amino sugar and nucleotide sugar metabolism
    Sbal_1483
Enzymes [BR:sbl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Sbal_1483
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD CTP_transf_3
Motif
Other DBs
NCBI-ProteinID: ABN61001
JGI: Sbal1483
UniProt: A3D2N8
Position
complement(1724528..1725436)
Genome map
AA seq 302 aa AA seqDB search
MKQHQIRKAVIPVAGLGTRMLPATKAIPKEMLPVVDKPLIQYVVSEAIAAGIKEIVLVTH
ASKNSIENHFDTSFELEAQLERRVKRQLLEAVQSICPKDVTVISVRQSQAKGLGHAILCA
KSVVGDAPFAVLLPDVIIDEASCDLRRDNLAAMVALFDETQVGQIMVEGVPHNVVNQYGI
ADVNGHDLQPGESEPLVELVEKPAVDEAPSNLAVVGRYVLPASIWPLLAKTPAGAGDEIQ
LTDAIAMLMKQETVNAYYMEGKSHDCGNKQGYMRANVEYALRHSEIGEDFAQYLKTVVKG
MK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaacatcaaattcgtaaagccgttattcctgtcgcaggcctaggcactcgtatg
cttccagcgaccaaagcgattccaaaggaaatgttaccggttgtcgataagccattgatc
caatatgtggtcagtgaagctatcgcagctgggatcaaagaaattgtcctagtgacccac
gccagtaaaaactctatcgaaaaccacttcgataccagtttcgaattagaagcccaactc
gagcgccgcgttaaacgtcagttactcgaagccgtacaatctatctgccctaaagacgtg
acggtgatcagcgtgcgtcaatctcaggcgaaaggattaggccacgccattttgtgcgca
aaatcagtcgtcggcgatgcaccatttgcagtattactgccggatgtgatcatcgatgaa
gccagctgtgatctgcgtcgcgataacttagccgctatggttgcgctgtttgatgaaacc
caagtgggtcaaatcatggttgaaggcgtgccgcacaacgtcgtcaatcagtacggtatt
gctgatgtgaatggccatgatttacaacctggtgaatctgagccattagttgaattggtt
gagaaaccagccgtggatgaagcgccatctaacttagccgttgtaggccgttatgtatta
cctgccagcatttggccactactggctaaaacccctgcgggcgctggcgatgaaattcaa
ttaacggatgcgattgccatgttaatgaaacaagaaaccgtgaacgcttattatatggaa
ggcaagagtcacgactgtggtaacaagcaaggttacatgcgcgcgaacgttgaatatgct
ctgcgccacagcgaaatcggtgaagattttgcacaatatttaaaaaccgttgtaaaaggg
atgaagtaa

DBGET integrated database retrieval system