KEGG   Shewanella baltica OS155: Sbal_2104Help
Entry
Sbal_2104         CDS       T00478                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
sbl  Shewanella baltica OS155
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2442623..2443651
Genome map
AA seq 342 aa AA seqDB search
MSSTAENKELDSAAQILRLAVPQMSALDIPVTPENYTVWYEYFAGTNLDLNRAIDGFLAN
SVSFTKEVNTSLYKNFIQEQSPEVIENVQIETQILINSLLSKISQLSQGTAAFSGSLAEF
GLRLQTNPDINTLNELVDGVVDEMQMLLINNREMEQSLCTMGQEVQNLKSEMENLSLAAM
TDQLTSLHNRRAYELSIQDQIYLSQDHQTRCSLLLIDIDNFKAFNDTYGHLTGDKVLAYV
ALALKQCVRGDDFVARYGGEEFVVVLPNTHFHDALQVAENLRERISERRLTIGKDKKLSL
GAITVSIGLASLQQGDDAETLFGRADKALYQAKAEGRNCVRG
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctactgcagaaaataaagagcttgattctgccgcgcaaattttgcgtttggcc
gtaccgcaaatgtctgccctcgatatccccgttacacctgaaaactacactgtttggtat
gaatattttgcagggacaaatctcgatttaaaccgtgcgattgatggctttctggctaat
tcggtctcttttactaaggaggtcaataccagcctgtataagaactttattcaagaacag
tcacccgaagtgattgaaaatgttcagattgaaacgcaaatcctgatcaatagtttgtta
agtaaaatcagccagttgagtcaaggcaccgcggcgttttcaggttcattagccgagttt
ggtttacgcctacagacaaatcccgacattaataccttaaacgagctggttgacggtgta
gtcgatgaaatgcagatgctactcatcaacaaccgtgagatggagcaaagcctgtgcacc
atgggccaagaagtgcaaaatcttaaatcggaaatggaaaacctgagcctagcagcgatg
actgaccaattaacctcgctgcacaatcgccgtgcctacgagttaagtattcaagatcaa
atctacctctcccaagatcaccaaacccgttgcagtcttttactgatcgatattgataat
tttaaagcctttaacgacacctatggtcatttgaccggcgataaagtgttggcctatgtc
gcattagccttgaaacaatgtgtgcgaggggatgactttgtggcgcgctatggcggcgaa
gaatttgtggtggtgttacctaacactcattttcacgatgcattacaagtggctgaaaat
cttcgggaacgtatctctgagcgccgcttaaccatagggaaagacaaaaagctttccctt
ggcgccattactgtttcgattggtctggcttcattgcagcaaggtgacgatgcagaaacc
ctattcggtcgcgccgacaaagcgctatatcaagctaaggccgaaggccgtaactgcgtg
agaggataa

DBGET integrated database retrieval system