KEGG   Shewanella baltica OS155: Sbal_2280Help
Entry
Sbal_2280         CDS       T00478                                 

Definition
(GenBank) exodeoxyribonuclease V, alpha subunit
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Sbal_2280
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Sbal_2280
DNA repair and recombination proteins [BR:sbl03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Sbal_2280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 Viral_helicase1 UvrD_C_2 Helicase_RecD AAA_11 AAA_22 UvrD_C UvrD-helicase DUF2075 AAA_28 PhoH SRP54 AAA_16 PIF1 NTPase_1 T2SSE ResIII Flavi_DEAD ArgK NACHT
Motif
Other DBs
NCBI-ProteinID: ABN61776
JGI: Sbal2280
UniProt: A3D4W3
Position
2645781..2648000
Genome map
AA seq 739 aa AA seqDB search
MMRSTQGLNAHSLSAAKWIDHGAIQLTAPLPELLKQWEQERLLTPLDRHFALEMSLLHPS
DSQQPLFILLCALLSQQLSSQHSCLVLAHIVPLNPMAEQNSHCKISLSLEALTETLQSFD
AVGQAGSNKPLILDNGRLYLQRYHQFETSVAASLIRLSGSVSKHSEDASHQEHTQTAKLR
SLLDQLFPANLLAPHSLTRNAITTNVITKSEGTQSAATIDWQKVATATALGKKLSVITGG
PGTGKTTTVTKLLLLLQMESQQEIRLVAPTGKAAARLSESIKASKARLAKELSTHADVVD
DARNRNNQDFLTALGRIPEEASTLHRLLGVIPNSPHFRHHQGNPLRLDLLIVDEASMVDL
PMMYKLLSALPEHASLILLGDQDQLASVEAGAVLADICAGLKMPVAPNNLAQNNIASNNQ
ALWQMRYSKEQALRLSALTGFELTPYISDAPKLGDSLCMLMHSHRFKGDAGIGLLASAVN
RADLQGILQVWQQGPAELSWLEHSMVVSQTQAKVSEPVNNAGLNLLLEQACQQYGAYLSA
LNSLASNSDVGTRPSTADIIESFNQYRILCAMRSGDYGVEGINQFVTQALANAKLIKPLQ
EFYLGRPIIIQSNDYNLGLFNGDIGLILQDEDKPERLMAHFIKADGSLLKVLPARLPSHE
TCYAMTVHKSQGSEFSRVALVLPPSPSLAQWQLLTKELVYTAITRAKVHFTCLGTQHVFE
RASSQATQRASGLADRLWG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctcaacccaagggctaaatgcacattcactctcagccgcgaaatggatagac
catggcgcaatccagcttaccgcgccgctaccagagctgttgaaacagtgggagcaagaa
cgactgctcacgccactcgatcggcatttcgcactcgagatgagtctcttacatccaagc
gacagccaacaacccttgtttattttgctatgcgcgctgttgagccagcaattatcttca
cagcacagctgcctagtgctcgcccatatcgtgccgcttaatcctatggccgagcaaaat
agccattgtaaaatcagtttaagtctcgaagcgctaacagagaccttgcaaagctttgat
gccgttggccaagctggcagtaacaaaccacttattttggataatggcagactctatcta
caacgttatcatcaatttgaaacctcagtggccgcttctttaatccgcctatcaggcagc
gtatctaagcactctgaagacgcaagccaccaagagcatactcaaaccgctaaattgagg
tcactgttagatcaactgttccctgccaatctgctcgcgccccattcactcactcgcaat
gcaatcactaccaatgtaatcactaaaagtgaaggcacacaaagcgcagcgacgattgat
tggcaaaaggtcgccacggccacagcgctgggtaaaaaattgtcggtgatcactggcggc
cctggcacaggtaaaaccaccactgtgactaagcttttgttattgttacaaatggaatca
caacaggaaatccgtttagtcgcgccaacgggaaaagccgcggctcgattaagcgagtca
atcaaagcctcaaaagcgcggctggcgaaggaactcagcacccatgctgatgttgttgac
gacgctcgcaatagaaataaccaagactttctaaccgcactggggcgaattccagaggag
gcatcaaccttacacaggctgctcggggtgatacccaattcgccgcactttcgccatcat
caaggtaatccgctgcggctcgacttattgatcgtcgacgaagcctctatggtcgatttg
cccatgatgtataaattgctcagcgccttgcccgagcacgccagtttgattttactcggc
gatcaggatcaactcgcctcggttgaggctggcgctgtgctcgccgatatttgtgctggc
ctgaaaatgccagtagctcccaataaccttgcgcaaaacaacatagcatctaacaaccaa
gctctgtggcaaatgcgctattccaaggaacaagccctgcgcctgagcgctttaacgggt
tttgagttaacaccctatatcagcgatgcgcctaaacttggcgatagcttgtgtatgcta
atgcacagtcacagatttaaaggcgatgcagggattggactgctcgctagcgccgtcaat
cgcgcggatcttcaaggcatattgcaagtatggcaacagggacccgcagaattaagctgg
ctagaacacagcatggtcgtaagccaaacccaagccaaagtgagcgagccggttaataat
gcgggactcaatttactgctagagcaagcctgccaacaatatggcgcctatctcagcgcc
ttgaatagccttgcaagtaatagtgatgtaggcacacgtccaagcacggctgacatcata
gaaagctttaaccagtaccgcattttatgcgccatgcgctcgggcgattatggggtcgaa
ggtatcaatcaatttgtgactcaagcactggccaatgccaagctgattaaaccgctacag
gagttttatctgggtcggcccattatcatccaaagcaatgactataacttaggcctgttt
aacggtgatattgggctgattttgcaggatgaagataaacccgaacgtttaatggcgcac
ttcatcaaggccgatggcagcctgttaaaagtcttgccagcacgtttgcccagccatgaa
acctgttacgccatgacggtacacaaaagccaaggcagcgaatttagccgtgtggcctta
gtgctgccaccgagccccagcttagcgcagtggcaactgctgaccaaagagttggtctat
accgccatcacccgcgctaaagtgcattttacctgcttaggcacccagcacgtattcgag
cgggccagcagtcaagcaacccaacgcgcatcgggtcttgctgacaggctttggggttaa

DBGET integrated database retrieval system