KEGG   Shewanella baltica OS155: Sbal_2348Help
Entry
Sbal_2348         CDS       T00478                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sbl  Shewanella baltica OS155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Sbal_2348
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     Sbal_2348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2733165..2734457
Genome map
AA seq 430 aa AA seqDB search
MESSPTPQQDLHTSQTRHAQTLTRRSRLALAVAASLLGTIGFTACSPTSNSATPSMSGNA
ASNVQQVAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDAKQNPISRVWFSLAQGILTE
TMYGLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINKDIEG
KYQIEKHIFTDPDRDTLMMRVTFTAFEDGITPHLYVNPHIDNAGANDIGRIDTHTDNHAN
THASNQALVAYTAAKDSSVMTVKSDLNFVQATTGFVGVSDGLADLADNGTLDKPYQTTSA
QDKSTVGNIAFTASYPTLIKAKPVTFNLAIGFGKDEAQSLANADATLAAGYDAVLSAYKG
DATHVGWHDYLSSLPAIANMANNTTDSGKLLYTSAMVLKAQEDKTCGRTDRLVIQSLGRY
GFSSRAEYWL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagtcctacgccgcagcaggatctgcacactagccaaacccgtcacgcacaa
acgttaacaaggcgcagccgcctagcgcttgccgtcgccgcaagtctattagggacaata
ggattcactgcttgttcacccacatcgaattcagcaacaccgagcatgagtggcaatgcc
gcatcaaatgtgcagcaggttgcgcccggcgcaccgggtaaagcgccgacttgggcattt
tcaggtaaaaccggtattggaacgtcgtacgaaccttacacccaaggtcaataccaagat
gccaagcaaaatcccattagccgcgtttggttctccctcgcccaaggtattttaaccgaa
accatgtatggtctgatccataatgcgcagctcaaagaactgcaatttgtgatcacggga
aatggctttgtcgatacagaaaaagataacaccatcagcagcatagaatatttagatacc
gatgctaatggtcgcccacaatcccttgcctataaaattatcaataaagatattgaaggt
aagtatcagattgaaaagcatatctttaccgatcctgaccgcgacaccctaatgatgcgc
gtcacctttaccgcctttgaagacggcattacgccgcatttgtatgtcaatccgcatatc
gataacgcaggcgccaatgatatcggccgcatcgatactcatactgacaatcatgccaac
actcatgctagtaatcaggcgctggtggcctataccgccgccaaagacagcagcgtgatg
acggtgaaatccgatctcaattttgtgcaggcaacgacaggctttgtcggcgtctctgat
ggcctagccgatttggccgataacggcacactcgataagccctatcaaacgacaagtgcg
caagataaatcgaccgttggcaatatcgcctttactgcgagttaccctacgctcatcaaa
gccaaacccgtcacttttaatctcgccatcggttttggtaaagatgaagcacagagttta
gccaatgccgatgccactttggccgcaggttatgatgctgtgctgagcgcctacaaaggc
gatgccacccatgtcggctggcacgattacttaagctcgctgcccgccatcgcaaacatg
gccaacaacaccactgatagcggtaagctgctgtataccagtgctatggtcttgaaagcg
caggaagataaaacatgcgggcgcactgatcgcctcgttatccaatccttggggcgatac
ggtttcagcagccgtgccgagtactggctataa

DBGET integrated database retrieval system