KEGG   Shewanella baltica OS155: Sbal_2348Help
Entry
Sbal_2348         CDS       T00478                                 

Definition
glucan 1,4-alpha-glucosidase (EC:3.2.1.3)
Orthology
K01178  
glucoamylase [EC:3.2.1.3]
Organism
sbl  Shewanella baltica OS155
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2733165..2734457
Genome map
AA seq 430 aa AA seqDB search
MESSPTPQQDLHTSQTRHAQTLTRRSRLALAVAASLLGTIGFTACSPTSNSATPSMSGNA
ASNVQQVAPGAPGKAPTWAFSGKTGIGTSYEPYTQGQYQDAKQNPISRVWFSLAQGILTE
TMYGLIHNAQLKELQFVITGNGFVDTEKDNTISSIEYLDTDANGRPQSLAYKIINKDIEG
KYQIEKHIFTDPDRDTLMMRVTFTAFEDGITPHLYVNPHIDNAGANDIGRIDTHTDNHAN
THASNQALVAYTAAKDSSVMTVKSDLNFVQATTGFVGVSDGLADLADNGTLDKPYQTTSA
QDKSTVGNIAFTASYPTLIKAKPVTFNLAIGFGKDEAQSLANADATLAAGYDAVLSAYKG
DATHVGWHDYLSSLPAIANMANNTTDSGKLLYTSAMVLKAQEDKTCGRTDRLVIQSLGRY
GFSSRAEYWL
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgagtcctacgccgcagcaggatctgcacactagccaaacccgtcacgcacaa
acgttaacaaggcgcagccgcctagcgcttgccgtcgccgcaagtctattagggacaata
ggattcactgcttgttcacccacatcgaattcagcaacaccgagcatgagtggcaatgcc
gcatcaaatgtgcagcaggttgcgcccggcgcaccgggtaaagcgccgacttgggcattt
tcaggtaaaaccggtattggaacgtcgtacgaaccttacacccaaggtcaataccaagat
gccaagcaaaatcccattagccgcgtttggttctccctcgcccaaggtattttaaccgaa
accatgtatggtctgatccataatgcgcagctcaaagaactgcaatttgtgatcacggga
aatggctttgtcgatacagaaaaagataacaccatcagcagcatagaatatttagatacc
gatgctaatggtcgcccacaatcccttgcctataaaattatcaataaagatattgaaggt
aagtatcagattgaaaagcatatctttaccgatcctgaccgcgacaccctaatgatgcgc
gtcacctttaccgcctttgaagacggcattacgccgcatttgtatgtcaatccgcatatc
gataacgcaggcgccaatgatatcggccgcatcgatactcatactgacaatcatgccaac
actcatgctagtaatcaggcgctggtggcctataccgccgccaaagacagcagcgtgatg
acggtgaaatccgatctcaattttgtgcaggcaacgacaggctttgtcggcgtctctgat
ggcctagccgatttggccgataacggcacactcgataagccctatcaaacgacaagtgcg
caagataaatcgaccgttggcaatatcgcctttactgcgagttaccctacgctcatcaaa
gccaaacccgtcacttttaatctcgccatcggttttggtaaagatgaagcacagagttta
gccaatgccgatgccactttggccgcaggttatgatgctgtgctgagcgcctacaaaggc
gatgccacccatgtcggctggcacgattacttaagctcgctgcccgccatcgcaaacatg
gccaacaacaccactgatagcggtaagctgctgtataccagtgctatggtcttgaaagcg
caggaagataaaacatgcgggcgcactgatcgcctcgttatccaatccttggggcgatac
ggtttcagcagccgtgccgagtactggctataa

DBGET integrated database retrieval system