KEGG   Shewanella baltica OS155: Sbal_2367Help
Entry
Sbal_2367         CDS       T00478                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sbl  Shewanella baltica OS155
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:sbl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2756032..2757174
Genome map
AA seq 380 aa AA seqDB search
MMPADDYPVTELTKALIARPSVTPLDEGCQTLMAERLSAIGFNIEPMVFEDTTNMWARRG
NEGPVFCFAGHTDVVPTGDVSRWHTPPFVPTIIDGYLYGRGAADMKGSLAAMVIATECFV
AKHPDHNGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTLKLGDVVKN
GRRGSLTGNLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQMHWDNGNEFFPPTSFQIAN
INGGTGASNVIPGALDVMFNFRYSTEVTADILIERVEALLKAHELDYDISWIFNGLPFLT
GDGPLLDATRIAIRQVTGYETDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECVK
VDDLEQLALCYEVILEQLLC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgccagccgatgattatcccgtaacggaactaacaaaagcgctgatcgcccgccct
tcggtgacgccacttgatgaaggctgccaaaccttaatggctgaaagactcagcgccatc
ggctttaatatcgaacctatggtatttgaagacaccaccaatatgtgggctcgccgtggc
aatgaaggtccggtcttttgttttgccggccacacagatgttgtgccaacgggtgatgtg
agccgctggcacacgccgccttttgtgcccaccatcattgatggctacttatatggccgc
ggcgccgcagacatgaaaggttcattggcggctatggtcattgccacagaatgttttgtg
gctaaacatcccgatcataatggctcaatcgcctttttgatcaccagcgatgaagaaggc
cccttcatcaacggcacgacgcgagtcattgataccttagaagcgcgcaacgagaagatc
acctgggcgttagtcggcgaaccctcatcaaccctaaagctgggcgatgtggtcaaaaat
ggtcgccgcggcagtttaaccggcaacttaaccgtgaaaggcattcaaggccacgtggcc
tatccacatcttgccgataatccaatccacaaagccgcgcctttcttagctgagctgagt
cagatgcactgggataatggcaatgagttctttccgcccaccagcttccaaatcgccaat
attaatggcggcaccggcgcatcgaatgtgatccccggcgcactggacgtgatgtttaac
ttccgttactccaccgaagtgacagccgacatcttgattgagcgggttgaagccttattg
aaagcccatgagctagattacgatatcagctggatttttaatggcctgccatttttaacc
ggcgatggcccactgcttgacgcgacccgtattgcgatccgccaagtcacaggctatgag
acagatccacaaaccacaggcggcacatcggacggacgctttatcgcgccaacgggtgcc
aaagtgttagagcttggcccagtgaacgccaccattcataaagtgaatgaatgcgttaaa
gtggacgaccttgagcagctagccctgtgctatgaagtgattttggaacaactattgtgc
taa

DBGET integrated database retrieval system