KEGG   Shewanella baltica OS155: Sbal_2367Help
Entry
Sbal_2367         CDS       T00478                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00300  Lysine biosynthesis
sbl01100  Metabolic pathways
sbl01120  Microbial metabolism in diverse environments
sbl01230  Biosynthesis of amino acids
Module
sbl_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Sbal_2367
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Sbal_2367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABN61860
JGI: Sbal2367
UniProt: A3D547
Position
2756032..2757174
Genome map
AA seq 380 aa AA seqDB search
MMPADDYPVTELTKALIARPSVTPLDEGCQTLMAERLSAIGFNIEPMVFEDTTNMWARRG
NEGPVFCFAGHTDVVPTGDVSRWHTPPFVPTIIDGYLYGRGAADMKGSLAAMVIATECFV
AKHPDHNGSIAFLITSDEEGPFINGTTRVIDTLEARNEKITWALVGEPSSTLKLGDVVKN
GRRGSLTGNLTVKGIQGHVAYPHLADNPIHKAAPFLAELSQMHWDNGNEFFPPTSFQIAN
INGGTGASNVIPGALDVMFNFRYSTEVTADILIERVEALLKAHELDYDISWIFNGLPFLT
GDGPLLDATRIAIRQVTGYETDPQTTGGTSDGRFIAPTGAKVLELGPVNATIHKVNECVK
VDDLEQLALCYEVILEQLLC
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgatgccagccgatgattatcccgtaacggaactaacaaaagcgctgatcgcccgccct
tcggtgacgccacttgatgaaggctgccaaaccttaatggctgaaagactcagcgccatc
ggctttaatatcgaacctatggtatttgaagacaccaccaatatgtgggctcgccgtggc
aatgaaggtccggtcttttgttttgccggccacacagatgttgtgccaacgggtgatgtg
agccgctggcacacgccgccttttgtgcccaccatcattgatggctacttatatggccgc
ggcgccgcagacatgaaaggttcattggcggctatggtcattgccacagaatgttttgtg
gctaaacatcccgatcataatggctcaatcgcctttttgatcaccagcgatgaagaaggc
cccttcatcaacggcacgacgcgagtcattgataccttagaagcgcgcaacgagaagatc
acctgggcgttagtcggcgaaccctcatcaaccctaaagctgggcgatgtggtcaaaaat
ggtcgccgcggcagtttaaccggcaacttaaccgtgaaaggcattcaaggccacgtggcc
tatccacatcttgccgataatccaatccacaaagccgcgcctttcttagctgagctgagt
cagatgcactgggataatggcaatgagttctttccgcccaccagcttccaaatcgccaat
attaatggcggcaccggcgcatcgaatgtgatccccggcgcactggacgtgatgtttaac
ttccgttactccaccgaagtgacagccgacatcttgattgagcgggttgaagccttattg
aaagcccatgagctagattacgatatcagctggatttttaatggcctgccatttttaacc
ggcgatggcccactgcttgacgcgacccgtattgcgatccgccaagtcacaggctatgag
acagatccacaaaccacaggcggcacatcggacggacgctttatcgcgccaacgggtgcc
aaagtgttagagcttggcccagtgaacgccaccattcataaagtgaatgaatgcgttaaa
gtggacgaccttgagcagctagccctgtgctatgaagtgattttggaacaactattgtgc
taa

DBGET integrated database retrieval system