KEGG   Shewanella baltica OS155: Sbal_2518Help
Entry
Sbal_2518         CDS       T00478                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00020  Citrate cycle (TCA cycle)
sbl00190  Oxidative phosphorylation
sbl00650  Butanoate metabolism
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01120  Microbial metabolism in diverse environments
sbl01130  Biosynthesis of antibiotics
sbl01200  Carbon metabolism
Module
sbl_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sbl_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
sbl_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal_2518
   00650 Butanoate metabolism
    Sbal_2518
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal_2518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABN62011
JGI: Sbal2518
UniProt: A3D5J8
Position
complement(2942935..2943282)
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactatattctactacgc
gctagtgcagtgatcctcgcctgttacaccattttcttggttggctttattgcatgtagt
tcccctctcacctacgacgtgtggcatagcctttttagcgctctgccgatgaaagtgttt
acacttctggcgctggtcgcattattggtacacgcttggattggtgtatggcaagtgctg
acagattacgtcaagtgcacgtcgttacgtggtgttttacagttcacctttgtcgttacc
gtattttgttatttagcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system