KEGG   Shewanella baltica OS155: Sbal_2518Help
Entry
Sbal_2518         CDS       T00478                                 

Definition
putative succinate dehydrogenase, hydrophobic subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
sbl  Shewanella baltica OS155
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Sbal_2518
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Sbal_2518
   00650 Butanoate metabolism
    Sbal_2518
  Energy metabolism
   00190 Oxidative phosphorylation
    Sbal_2518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2942935..2943282)
Genome map
AA seq 115 aa AA seqDB search
MVTNAASFGRSGVHDYILLRASAVILACYTIFLVGFIACSSPLTYDVWHSLFSALPMKVF
TLLALVALLVHAWIGVWQVLTDYVKCTSLRGVLQFTFVVTVFCYLAAGIVIVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaaccaatgcagcaagttttggacgcagtggtgttcatgactatattctactacgc
gctagtgcagtgatcctcgcctgttacaccattttcttggttggctttattgcatgtagt
tcccctctcacctacgacgtgtggcatagcctttttagcgctctgccgatgaaagtgttt
acacttctggcgctggtcgcattattggtacacgcttggattggtgtatggcaagtgctg
acagattacgtcaagtgcacgtcgttacgtggtgttttacagttcacctttgtcgttacc
gtattttgttatttagcggccggcattgttattgtgtggggtgtctaa

DBGET integrated database retrieval system