KEGG   Shewanella baltica OS155: Sbal_2533Help
Entry
Sbal_2533         CDS       T00478                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
sbl  Shewanella baltica OS155
Brite
Enzymes [BR:sbl01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Sbal_2533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2962037..2963071
Genome map
AA seq 344 aa AA seqDB search
MTKLTSIAIFIAGIFASAHAISAEPIEVIKAVKVTEPEKVELGKMLFFEPRLSKSGYISC
NSCHNLATGGVDALPTSVGHNWQQGPINSPTVLNANYMLAQFWDGRASDLQAQAAGPIEN
PKEMGYSHALATQTIASMPAYRAHFAKVYGDENVTIDRLTDAISTFEKTLVTPNSPFDQY
LLGKQDAISVDAKAGYQLFKSKGCVSCHNGPAVGGTMYMKMGLIKPFHTNNPAKGRIAVT
GKEADKFVFKVPTLRNIELTYPYFHDGSVWTLEEAVNTMADIQLGQKLSDKENLEMVAFL
VSLTGDQPQITLPILPPSNKNTPRPVPFSHDPMSSKPVSDELLK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaactcacatctattgctattttcattgcgggtattttcgccagtgcccatgcc
atcagtgctgaacccatcgaagtgataaaagcggtgaaagtcactgaaccggagaaagtt
gaactcggtaaaatgctgttcttcgaaccaaggctatccaaatcgggctacatctcctgt
aactcttgccacaatttagccactggcggagtcgatgccctaccaacctctgttggccat
aattggcaacaaggcccgattaactcgcccacagtgctcaatgccaattatatgctggcg
caattttgggatggccgcgccagtgatttacaagcgcaagccgctggccctatcgagaat
cctaaggaaatgggctatagccatgcactcgcgacacaaactattgcctctatgccggcc
tatcgggcgcattttgccaaagtctatggcgatgaaaacgtcacgattgaccgcttaacc
gatgcgatttccacctttgaaaaaaccttagtcacgccaaatagtccgttcgatcaatat
ttattgggtaagcaagatgcgatcagtgtggatgccaaagcgggttaccaactgtttaag
agcaaagggtgcgtaagctgccataacggtccagccgtcggtggcactatgtatatgaag
atgggattgattaaacctttccacaccaataatcccgccaaaggtcgtatcgcagtcaca
ggtaaagaagccgataagtttgtctttaaagtgccgacactgcgcaatattgaactcacc
tatccctacttccacgacggcagtgtctggaccttagaagaagcggtgaacactatggcc
gatattcaattaggccaaaaactgtcggacaaagaaaatctagaaatggtcgcctttctc
gtctcgttgacgggggatcaacctcagatcaccttgccgattttgccgccatccaacaag
aacacaccgcgcccagtaccttttagccatgatccaatgagtagcaagccagttagcgat
gagctattaaagtag

DBGET integrated database retrieval system