KEGG   Shewanella baltica OS155: Sbal_2704Help
Entry
Sbal_2704         CDS       T00478                                 

Definition
(GenBank) phosphoribosylanthranilate isomerase / indole-3-glycerol phosphate synthase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sbl01100  Metabolic pathways
sbl01110  Biosynthesis of secondary metabolites
sbl01130  Biosynthesis of antibiotics
sbl01230  Biosynthesis of amino acids
Module
sbl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal_2704
Enzymes [BR:sbl01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Sbal_2704
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Sbal_2704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ABN62192
JGI: Sbal2704
UniProt: A3D629
Position
3170862..3172349
Genome map
AA seq 495 aa AA seqDB search
MSQVEVTPTAMTQDLRTQPEAATNAMPKSNVLTRIVDTKTAHIAALKLRFPEASLSPKIS
DRSLFSALKAPKAGYILECKKASPSKGLIRDVFDVEAIADIYGKYAAGISVLTDEQFFQG
DMDYIPKVRARVNQPILCKDFFVDEYQIKLAAHQGADAILLMLSVLDDEQYQGLAKEAAK
YQLDVLTEVSNEEELKRAIALDAPIIGINNRNLRDLSTDLATTEALAPHIGSDRVVISES
GIYNNEQVRRLSPLVDGFLVGSSIMAEADIDLACRKLIFGHNKVCGLTRVEDIRAAATAG
AVYGGLIFAEKSPRALTLNAAEQLLKEYRASDAPAIEFVGVFVNAAPSTITDIAASLQLS
AVQLHGTETELEITQLAERLEQAGLTTQIWKAVSVDAQTGELGNLPQGAQRYLFDSKTAG
QFGGSGQAFNWQNIDVKSLGQQKAHAMLAGGLNADNAASANAQGFYGLDFNSGLETAAGI
KSAQLIQTAFTHLRL
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgtctcaagtagaagtgactccaacagcaatgactcaagacctgcgtactcagccagag
gcagccacaaacgctatgccaaaaagtaatgtgttaacccgtatcgtcgataccaaaacg
gcccatattgccgccctaaaactgcgtttccctgaggcgagtctgtcgccaaaaatctct
gaccgcagtttattttccgcactcaaggcacccaaggcgggttacattttagaatgcaaa
aaagccagtccgtccaaagggcttatccgcgatgtgtttgatgtagaagccatcgccgat
atttacggtaaatatgcggcgggcatttcggtattaaccgacgagcaatttttccaaggg
gatatggactatattcctaaggtgcgcgctcgggtgaaccaaccgattctgtgcaaagat
ttttttgtggatgaataccaaatcaaactcgccgctcaccaaggcgccgatgcgattctg
ttgatgctgtccgtgcttgatgatgaacaatatcaaggtctagcgaaagaagccgctaag
tatcaactcgatgtactgaccgaagtcagtaacgaagaagaacttaagcgcgccatcgca
ttagatgcgccgattattggcatcaacaaccgtaacttaagggatttaagtaccgatctc
gccaccacagaagccttagcgccacacattggcagcgaccgcgtggtgatcagcgaatct
ggcatctacaacaatgagcaagtacgtcgcctaagtccgctggttgatggcttccttgtc
ggcagctcgattatggctgaggctgatatcgacttggcctgccgtaaattgatcttcggt
cacaataaagtctgcggcctcacccgtgtggaagatattcgcgccgcggcaacagcaggc
gctgtctatggcggactgatttttgctgaaaaatccccacgcgcgttaacccttaatgcc
gcagaacaactactcaaggagtaccgagcatctgatgcccccgccattgaatttgtcggc
gtgtttgttaatgccgcgccaagcaccatcaccgatatcgctgccagtttgcagttatct
gccgtacagctgcatggcactgagactgagcttgaaataacacagctcgctgagcgactt
gaacaagcgggactcaccacccaaatttggaaagccgtcagcgtcgatgcgcaaacgggt
gagcttggcaacttacctcagggagcacagcgttatctgtttgatagtaaaacggcaggt
caatttggcggctcaggccaagcctttaattggcaaaatattgatgtgaagtccttaggc
cagcaaaaggcccatgccatgttggcgggcggactcaacgctgacaatgcagccagtgcc
aatgcccaaggattttacggtttagattttaattctggcctagaaaccgccgcaggaatt
aagtcggcgcaactgatccaaacggcttttacccatttacgtctctag

DBGET integrated database retrieval system