KEGG   Shewanella baltica OS155: Sbal_2706Help
Entry
Sbal_2706         CDS       T00478                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbl  Shewanella baltica OS155
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Sbal_2706
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Sbal_2706
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Sbal_2706
Enzymes [BR:sbl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Sbal_2706
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3173743..3174564
Genome map
AA seq 273 aa AA seqDB search
MSDTLTNTGRYQATFAKLKAEGRGAFVPFVTLGDPSPELSLKIIDTLVQNGADALELGFP
FSDPLADGPVIQGANLRSLAAGTTPTACFELLAQVRAKYPELPIGLLLYANLVFANGIDA
FYAKAQQAGVDSVLIADVPVEESAPFSEAAKAHGIAPIFIAPPNADSETLALVSASGEGY
TYLLSRAGVTGTDTKAGVPVEEILSKLKTFNAPPPLLGFGIAEPAQVSAAIKAGAAGAIS
GSAVVKIIETHQHDEAKLLATLGDFTRAMKAAT
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgagtgatacattgactaacactggccgttaccaagccacctttgccaaactcaaagcc
gaaggccgtggtgcttttgtcccattcgtcacccttggcgaccctagccctgagttatcg
ctgaaaattatcgataccttagtgcaaaacggtgcagatgccttagaactgggctttccg
ttttccgatcccttggccgatggccctgtgatccaaggtgctaacctgcgttctttagct
gcgggcacgactccaacggcgtgttttgaattactggcgcaagtgcgtgctaaatatcct
gaactgccaatcggtttgctgctgtatgcgaacttggtgtttgctaatggcatagatgcg
ttttacgccaaagcgcagcaagcgggtgtggattcagtgcttattgccgacgtacccgtg
gaagaatcggcgccctttagcgaagcggctaaagcccatggtattgcgccaatttttatc
gcgccgcccaatgccgacagtgaaacccttgcactggttagcgccagcggtgaaggttac
acctatctcttatcccgcgcaggggtgacaggcacagacactaaagctggcgttccggtg
gaagaaattctatccaagttgaaaacttttaacgcgccgccaccgctactcggctttggc
attgccgaacccgctcaagtgagcgccgcaatcaaagcaggcgctgcaggggcaatttca
ggctctgctgtcgtgaaaatcatcgaaacccaccagcacgatgaagctaagctactggcg
acacttggcgattttactcgcgccatgaaagcggcgacctaa

DBGET integrated database retrieval system