KEGG   Shewanella baltica OS155: Sbal_3226Help
Entry
Sbal_3226         CDS       T00478                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sbl  Shewanella baltica OS155
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sbl00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3781262..3782593)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALCSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLELNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNEADARAKL
NRVLDNGRAAELFGKMVSGLGGPADFVENYSKYLPQSQIIRPVFADMQGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKVDSSTPIAVIHAQSEAAFAEAELAVKKA
IHIGETAPEKTPEIYAYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctctgttccgaa
gaaatacagttctttgtacaaggtatcaccaccaactctgtatctgaaggtcagatcgcc
gcattaggtatggcggtgtattttaatgacatgaatatggatgaaagaatcgctttaacg
acagcgatgcgagattcaggcactgtgcttaattggcaatcattggaactcaacggtcct
gtcatcgacaaacacagcactggtggtgtcggcgatgtgattagtctcatgcttggccct
atggctgcggcttgtggcggttatgtgcctatgatttctgggcgcggcctaggtcatact
ggcggtacactcgataagtttgatgccattccgggttaccaaactgagccttcaagtgaa
ttgttccgcaaagtggttaaagaagtcggggtggcgattattggccaaacgggcgatctc
gtccctgccgataaacgcttctattctattcgcgataataccgctaccgttgaatccatt
tccctcatcacagcgtcgattctgtctaagaaattagcctgtaatttagatgcgttggcg
atggacgtaaaagttggtagcggcgctttcatgccaacctatgaggcatcggaagaatta
gctcgcagtatcgccgccgttgcaaatggcgcgggtactaaaacgacggctttacttacc
gatatgaatcaagtgcttgcatcttgtgccggtaacgcggttgaagtgaaagaagccata
gactttttaacgggtgcttaccgtaacccgcgtttatatgaagtcactatgggtctttgt
gctgagatgctgctgcttggcggtcttgcaagcaatgaagccgatgctcgcgctaaactg
aatcgtgtactcgacaatggtcgcgccgcagagctctttggcaagatggtgtcgggtctt
ggtggtccagccgattttgttgaaaactacagtaaatacctgccgcagtcacaaattatt
cgtccggtttttgccgatatgcaaggttatgcctacagcatggatacccgtgagttaggt
ttagcggttgtgaccttaggtggcggccgtcgtaagcccggcgatgcactagactatagt
gttggcttaacccaagtgtgtgccctaggcgataaagtggattcatcgacgccaattgcg
gttatccatgcacagtctgaagccgcgttcgcagaagctgaacttgcggtgaaaaaagcg
attcacattggtgaaaccgctccagaaaaaacacctgagatctatgcctatattcgtgca
tcggatctttaa

DBGET integrated database retrieval system