KEGG   Shewanella baltica OS155: Sbal_3226Help
Entry
Sbal_3226         CDS       T00478                                 

Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sbl  Shewanella baltica OS155
Pathway
sbl00240  Pyrimidine metabolism
sbl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Sbal_3226
Enzymes [BR:sbl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Sbal_3226
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N SLBB
Motif
Other DBs
NCBI-ProteinID: ABN62706
JGI: Sbal3226
UniProt: A3D7J3
Position
complement(3781262..3782593)
Genome map
AA seq 443 aa AA seqDB search
MFLAQEIIRKKRNGLALCSEEIQFFVQGITTNSVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLELNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKEVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACNLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNAVEVKEAIDFLTGAYRNPRLYEVTMGLCAEMLLLGGLASNEADARAKL
NRVLDNGRAAELFGKMVSGLGGPADFVENYSKYLPQSQIIRPVFADMQGYAYSMDTRELG
LAVVTLGGGRRKPGDALDYSVGLTQVCALGDKVDSSTPIAVIHAQSEAAFAEAELAVKKA
IHIGETAPEKTPEIYAYIRASDL
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgtttctagctcaagagattattcgtaaaaaacgtaatggtttagcgctctgttccgaa
gaaatacagttctttgtacaaggtatcaccaccaactctgtatctgaaggtcagatcgcc
gcattaggtatggcggtgtattttaatgacatgaatatggatgaaagaatcgctttaacg
acagcgatgcgagattcaggcactgtgcttaattggcaatcattggaactcaacggtcct
gtcatcgacaaacacagcactggtggtgtcggcgatgtgattagtctcatgcttggccct
atggctgcggcttgtggcggttatgtgcctatgatttctgggcgcggcctaggtcatact
ggcggtacactcgataagtttgatgccattccgggttaccaaactgagccttcaagtgaa
ttgttccgcaaagtggttaaagaagtcggggtggcgattattggccaaacgggcgatctc
gtccctgccgataaacgcttctattctattcgcgataataccgctaccgttgaatccatt
tccctcatcacagcgtcgattctgtctaagaaattagcctgtaatttagatgcgttggcg
atggacgtaaaagttggtagcggcgctttcatgccaacctatgaggcatcggaagaatta
gctcgcagtatcgccgccgttgcaaatggcgcgggtactaaaacgacggctttacttacc
gatatgaatcaagtgcttgcatcttgtgccggtaacgcggttgaagtgaaagaagccata
gactttttaacgggtgcttaccgtaacccgcgtttatatgaagtcactatgggtctttgt
gctgagatgctgctgcttggcggtcttgcaagcaatgaagccgatgctcgcgctaaactg
aatcgtgtactcgacaatggtcgcgccgcagagctctttggcaagatggtgtcgggtctt
ggtggtccagccgattttgttgaaaactacagtaaatacctgccgcagtcacaaattatt
cgtccggtttttgccgatatgcaaggttatgcctacagcatggatacccgtgagttaggt
ttagcggttgtgaccttaggtggcggccgtcgtaagcccggcgatgcactagactatagt
gttggcttaacccaagtgtgtgccctaggcgataaagtggattcatcgacgccaattgcg
gttatccatgcacagtctgaagccgcgttcgcagaagctgaacttgcggtgaaaaaagcg
attcacattggtgaaaccgctccagaaaaaacacctgagatctatgcctatattcgtgca
tcggatctttaa

DBGET integrated database retrieval system