KEGG   Shewanella baltica OS155: Sbal_3493Help
Entry
Sbal_3493         CDS       T00478                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sbl  Shewanella baltica OS155
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4093866..4094354
Genome map
AA seq 162 aa AA seqDB search
MTRVYVALGANLEDPKTQLDNAVTALSSLALGNSLLVSPYYHSTPMGDVVQPDYVNAVAS
FDTDLEPLALLDALQHIENTQGRVRLERWGPRTLDLDILLYGNENIDIPRLKVPHYGMKE
RSFVLVPLAAIAPNLILPCNTAIGSLIDTKMLAELQQLGIDH
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgactcgcgtctacgtcgcattaggcgcaaatcttgaagatcccaagacgcaattggac
aatgccgtcacggcattgtcctcattagccttaggcaatagtctactggtttccccctat
taccattcgacgcccatgggcgatgtggtgcaacccgattatgttaatgcggtggccagt
ttcgatactgatcttgagccattagccttactcgatgcattgcagcatatcgaaaacacc
caaggacgagtgcgccttgaacgttgggggcccagaaccttagatctcgatatactcctg
tatggcaatgaaaacattgacattcccagactcaaagtgccccactacggcatgaaagag
cgcagctttgtgctcgtgcctttagccgcaatcgcaccgaatcttattctgccgtgcaac
actgcaatcggcagtcttatcgatacaaaaatgttggccgagttacaacaactgggcatt
gatcattga

DBGET integrated database retrieval system