KEGG   Shewanella baltica OS155: Sbal_3529Help
Entry
Sbal_3529         CDS       T00478                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sbl  Shewanella baltica OS155
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Sbal_3529
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Sbal_3529
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Sbal_3529
Enzymes [BR:sbl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Sbal_3529
Exosome [BR:sbl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Sbal_3529
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4148666..4149943
Genome map
AA seq 425 aa AA seqDB search
MLLSTPVWADETGPTKAPSRPKNIVIMIGDGMGPSYTSAYRYYKDNPDTEEVEQTVFDRL
LVGMASTYPASVSGYVTDSAAAATALATGVKSYNGAISVDTQKQPLPTILEKAKSLGLST
GVAVTSQINHATPAAFLAHNESRKNYDALALSYLETNADVFLGGGQKYFPPALLEQFKAK
GYQHISRFEDLASITQPKVLGLFAEVQLPWAIDEKDARKLSTLTQKALSLLSQNDQGFVL
LVEGSLIDWAGHNNDIATAMGEMDEFSNAIEVVEQFVREHPDTLMVITADHNTGGLSIGV
DGNYSWNPEILRNISASTDTLALAAITGEQWQADLARGLGFELSEEEVAKLNVARMQGLE
TMAVAIRHLIDKRTDTGWTTDGHTGTDVQVFAAGPASELFNGHQDNTDIANKIFSLLPKP
KKPKS
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
ttgctgttatctacgccagtttgggcagatgaaacgggtccaacgaaagcgccatcgcga
ccgaaaaatatcgtcattatgataggtgatggtatggggccgtcttacaccagcgcctac
cgctattacaaagataatcctgacactgaagaagtcgagcaaaccgtatttgaccgttta
ctggtgggcatggcgagcacctatcccgcgagcgtcagtggttatgtgactgactcagcc
gccgcggcaaccgcactcgccactggggtaaaatcgtataatggggcgatttcggtcgat
acccaaaagcaaccactgccgaccatactcgaaaaagccaaatcccttggcctcagcaca
ggtgtcgcggtaacgtcgcaaatcaaccacgccacaccagccgcctttttggcccacaac
gagagccgtaaaaactacgacgctctggcactcagctatttagaaaccaacgccgatgta
tttttaggcggtggtcaaaaatatttcccccctgcgctattagagcagttcaaagccaag
ggctatcaacacatcagccgttttgaggatctcgccagcatcacccaaccaaaagtgttg
ggcctgtttgccgaagtacaattgccttgggcgattgatgagaaagatgcaagaaaactc
agcaccttaactcaaaaggcactcagcttactgtcgcaaaatgaccaaggttttgtgttg
ttagtcgaagggagtctcatcgactgggcgggccacaataacgatatcgccactgccatg
ggtgagatggatgaattctccaatgccattgaagtggttgagcaatttgtgcgtgaacat
ccagataccctgatggtgatcaccgccgaccacaataccggtggcctatcgattggcgtc
gatggcaactacagctggaaccctgaaatcctgcgtaatatctcggccagcacagacact
ttggccttagccgccatcactggtgaacaatggcaagccgatctcgcccgtggtttaggc
tttgagcttagcgaagaagaagtcgcaaaattaaacgtcgccagaatgcagggattagaa
accatggcagtagcgattcgccatcttattgataaacgtactgatacaggttggacaacc
gacggccacacaggcacagacgtacaagtgtttgccgcaggtccggcgtctgagctgttt
aacggccatcaggacaataccgatatcgccaataagatttttagcttattgccaaaaccg
aagaaacctaaaagctaa

DBGET integrated database retrieval system