KEGG   Shewanella baltica OS155: Sbal_4288Help
Entry
Sbal_4288         CDS       T00478                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbl  Shewanella baltica OS155
Pathway
Starch and sucrose metabolism
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbl00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5024517..5025995
Genome map
AA seq 492 aa AA seqDB search
MKNQVQLITYVDRITNAGLKELKALLDDELQGLFGGVHLLPFYFPIDGSDAGFDPIDHVQ
VDSRLGNWDDVKHIGDDYDIMADLIVNHMSAESPEFKDVLKHGKQSAYWDLFLTKDKVFP
EGLSEQDQAAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVHSAAGKDYLNRVLA
RFDHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANALGMTTLAEIHSHHMT
QVEIAKRVDMVYDFALPPLILHTLFSQDCQALTHWLEMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLTENQIDNLVETIHGNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYAGLLAIPNDMDLLNNTHVGRDINRPYLNREKVQQAMQKPVVKA
LTQLIKLRNSSPAFDGRFTMASAERTLTLSWTAAEAQASLTLDFANKDGQIILLDKQGKE
TQVSLSRLLAQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagtgcaactgatcacctatgtcgacagaattaccaatgcagggctcaaa
gagctcaaagcgctgctcgatgacgagttgcaaggtctattcggcggcgtacatcttttg
cctttctatttccccattgacggcagcgatgcgggcttcgatccaatagaccatgtgcaa
gtcgattcacgcttaggcaattgggatgacgttaaacacattggtgatgactacgacatc
atggccgaccttatcgttaaccacatgtccgccgaatcaccagaatttaaagacgtgctc
aagcacggcaaacaatcggcttactgggatttatttttaaccaaagacaaggtatttcct
gaggggttaagcgagcaagatcaagccgctatctatcgtccgcgtccgggcagttgtttt
agcacttacaccttagccgatggctcgaccgaagagttttggaccacctttacccgcaat
caaatcgatatcgacgttcattccgccgcgggtaaagattatttaaaccgagtgctggcg
cgtttcgaccacagtaaagtgaatctgatccgcttagatgctgcgggttatgcaattaaa
aagcccggcactagctgctttatgattgaagagtccttcgagttcgtggataagttagct
aagcaagccaatgcgttaggtatgacaacgctggccgaaattcattcgcaccacatgact
caggtcgagatcgccaagcgggtcgacatggtgtacgacttcgccctgccaccgctcatc
ttgcacacgctgtttagccaagattgccaagccttgacccattggctggaaatggcgccg
cgcaactgcatcaccgtactcgacacccacgacggcatcggcattatcgacgtcggccct
atggatggcttgcgcggattattgaccgaaaatcaaatcgataatctggttgaaaccata
catggcaacagtaagggcgagagtctacaagccacaggcgcggccgccagcaacgtcgat
ttgtatcaaatcaactgcacctattacgatgccctcggtcagaatgacctagattatttg
atggcgcgggcgattcagtttttcgcacccggtattccgcaggtgtattacgcgggtctg
ctggcgattccaaacgatatggatctgctcaacaacacccatgtcggtcgcgatatcaat
cgcccttacttgaaccgtgaaaaagtgcagcaagctatgcagaaacctgtcgttaaggcg
ctaactcagctgattaaactgcgtaatagcagcccagccttcgatggccgctttacgatg
gcatcagcagaacgcacgttaactttatcttggacagcggccgaggctcaggcgagtctc
accctcgactttgccaataaagatggccaaatcatccttttagataagcaaggtaaagag
acacaagtgtcgttatcaagactgctggctcaagcataa

DBGET integrated database retrieval system