KEGG   Shewanella baltica OS155: Sbal_4566Help
Entry
Sbal_4566         CDS       T00478                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sbl  Shewanella baltica OS155
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sbl03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
pSbal01:104385..106604
Genome map
AA seq 739 aa AA seqDB search
MMRSTQGLNAHSLSAAKWIDHGAIQLTAPLPELLKQWEQERLLTPLDRHFALEMSLLHPS
DSQQPLFILLCALLSQQLSSQHSCLVLAHIVPLNPMAEQNSHCKISLSLEALTETLQSFD
AVGQAGSNKPLILDNGRLYLQRYHQFETSVAASLIRLSGSVSKHSEDASHQEHTQTAKLR
SLLDQLFPANLLAPHSLTRNAITTNVITKSEGTQSAATIDWQKVATATALGKKLSVITGG
PGTGKTTTVTKLLLLLQMESQQEIRLVAPTGKAAARLSESIKASKARLAKELSTHADVVD
DARNRNNQDFLTALGRIPEEASTLHRLLGVIPNSPHFRHHQGNPLRLDLLIVDEASMVDL
PMMYKLLSALPEHASLILLGDQDQLASVEAGAVLADICAGLKMPVAPNNLAQNNIASNNQ
ALWQMRYSKEQALRLSALTGFELTPYISDAPKLGDSLCMLMHSHRFKGDAGIGLLASAVN
RADLQGILQVWQQGPAELSWLEHSMVVSQTQAKVSEPVNNAGLNLLLEQACQQYGAYLSA
LNSLASNSDVGTRPSTADIIESFNQYRILCAMRSGDYGVEGINQFVTQALANAKLIKPLQ
EFYLGRPIIIQSNDYNLGLFNGDIGLILQDEDKPERLMAHFIKADGSLLKVLPARLPSHE
TCYAMTVHKSQGSEFSRVALVLPPSPSLAQWQLLTKELVYTAITRAKVHFTCLGTQHVFE
RASSQATQRASGLADRLWG
NT seq 2220 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgctcaacccaagggctaaatgcacattcactctcagccgcgaaatggatagac
catggcgcaatccagcttaccgcgccgctaccagagctgttgaaacagtgggagcaagaa
cgactgctcacgccactcgatcggcatttcgcactcgagatgagtctcttacatccaagc
gacagccaacaacccttgtttattttgctatgcgcgctgttgagccagcaattatcttca
cagcacagctgcctagtgctcgcccatatcgtgccgcttaatcctatggccgagcaaaat
agccattgtaaaatcagtttaagtctcgaagcgctaacagagaccttgcaaagctttgat
gccgttggccaagctggcagtaacaaaccacttattttggataatggcagactctatcta
caacgttatcatcaatttgaaacctcagtggccgcttctttaatccgcctatcaggcagc
gtatctaagcactctgaagacgcaagccaccaagagcatactcaaaccgctaaattgagg
tcactgttagatcaactgttccctgccaatctgctcgcgccccattcactcactcgcaat
gcaatcactaccaatgtaatcactaaaagtgaaggcacacaaagcgcagcgacgattgat
tggcaaaaggtcgccacggccacagcgctgggtaaaaaattgtcggtgatcactggcggc
cctggcacaggtaaaaccaccactgtgactaagcttttgttattgttacaaatggaatca
caacaggaaatccgtttagtcgcgccaacgggaaaagccgcggctcgattaagcgagtca
atcaaagcctcaaaagcgcggctggcgaaggaactcagcacccatgctgatgttgttgac
gacgctcgcaatagaaataaccaagactttctaaccgcactggggcgaattccagaggag
gcatcaaccttacacaggctgctcggggtgatacccaattcgccgcactttcgccatcat
caaggtaatccgctgcggctcgacttattgatcgtcgacgaagcctctatggtcgatttg
cccatgatgtataaattgctcagcgccttgcccgagcacgccagtttgattttactcggc
gatcaggatcaactcgcctcggttgaggctggcgctgtgctcgccgatatttgtgctggc
ctgaaaatgccagtagctcccaataaccttgcgcaaaacaacatagcatctaacaaccaa
gctctgtggcaaatgcgctattccaaggaacaagccctgcgcctgagcgctttaacgggt
tttgagttaacaccctatatcagcgatgcgcctaaacttggcgatagcttgtgtatgcta
atgcacagtcacagatttaaaggcgatgcagggattggactgctcgctagcgccgtcaat
cgcgcggatcttcaaggcatattgcaagtatggcaacagggacccgcagaattaagctgg
ctagaacacagcatggtcgtaagccaaacccaagccaaagtgagcgagccggttaataat
gcgggactcaatttactgctagagcaagcctgccaacaatatggcgcctatctcagcgcc
ttgaatagccttgcaagtaatagtgatgtaggcacacgtccaagcacggctgacatcata
gaaagctttaaccagtaccgcattttatgcgccatgcgctcgggcgattatggggtcgaa
ggtatcaatcaatttgtgactcaagcactggccaatgccaagctgattaaaccgctacag
gagttttatctgggtcggcccattatcatccaaagcaatgactataacttaggcctgttt
aacggtgatattgggctgattttgcaggatgaagataaacccgaacgtttaatggcgcac
ttcatcaaggccgatggcagcctgttaaaagtcttgccagcacgtttgcccagccatgaa
acctgttacgccatgacggtacacaaaagccaaggcagcgaatttagccgtgtggcctta
gtgctgccaccgagccccagcttagcgcagtggcaactgctgaccaaagagttggtctat
accgccatcacccgcgctaaagtgcattttacctgcttaggcacccagcacgtattcgag
cgggccagcagtcaagcaacccaacgcgcatcgggtcttgctgacaggctttggggttaa

DBGET integrated database retrieval system