KEGG   Shewanella baltica OS185: Shew185_0061Help
Entry
Shew185_0061      CDS       T00571                                 

Definition
sucrose phosphorylase
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbm  Shewanella baltica OS185
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Shew185_0061
Enzymes [BR:sbm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     Shew185_0061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(73333..74811)
Genome map
AA seq 492 aa AA seqDB search
MKNQVQLITYVDRITNAGLKELKALLDDELQGLFGGVHLLPFYFPIDGSDAGFDPIDHVQ
VDSRLGNWDDVKRIGDDYDIMADLIVNHMSAESPEFKDVLKHGKQSAYWDLFLTKDKVFP
EGLSEQDQAAIYRPRPGSCFSTYTLADGSTEEFWTTFTRNQIDIDVHSAAGKDYLNRVLA
RFDHSKVNLIRLDAAGYAIKKPGTSCFMIEESFEFVDKLAKQANALGMTTLAEIHSHHMT
QVEIAKRVDMVYDFALPPLILHTLFSQDCQALTHWLEMAPRNCITVLDTHDGIGIIDVGP
MDGLRGLLTENQIDNLVETIHGNSKGESLQATGAAASNVDLYQINCTYYDALGQNDLDYL
MARAIQFFAPGIPQVYYAGLLAIPNDMDLLNNTHVGRDINRPYLNREKVQQAMQKPVVKA
LTKLIKLRNSSPAFDGRFTMASAERTLTLSWTAADSQASLTLDFANKDGQIILLDKQGKE
TQVSLSKLLAQA
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaccaagtgcaactgatcacctatgtcgacagaattaccaatgcagggctcaag
gagctcaaagcgctactcgatgacgagttgcaaggtctattcggcggcgtacatcttttg
cctttctatttccccattgacggcagcgatgcgggcttcgatccgatagaccatgtgcaa
gtcgattcacgcttaggcaattgggatgacgttaaacgcattggtgacgactacgacatc
atggccgaccttatcgttaaccacatgtccgccgaatcgccagaatttaaagacgtgctc
aagcacggcaaacaatcggcttactgggatttgtttctaactaaagacaaggtatttcct
gaggggttaagcgagcaagatcaagccgctatctatcgtccacgtccgggcagttgcttc
agcacttacaccttagccgatggctcgaccgaagagttttggaccacctttacccgcaat
caaatcgatatcgacgttcattccgccgcgggtaaagattatttaaaccgagtgctggcg
cgtttcgaccacagtaaagtgaatctgatccgcttagatgctgcgggctatgcgattaaa
aagcccggcactagctgctttatgattgaagagtccttcgagttcgtggataagttagcc
aagcaagccaatgcgttaggcatgacaacgctggccgaaattcattcgcaccacatgact
caggtcgagatcgccaaacgggtcgacatggtgtacgacttcgccctgccaccgctcatc
ttgcacacgctgtttagccaagattgccaagccttgacccattggctggaaatggcgccg
cgcaactgcattaccgtactcgacacccacgacggcatcggcattatcgacgtcggccct
atggatggcttgcgcggattattgaccgaaaatcaaatcgataatctggttgaaaccata
catggcaacagtaagggcgagagtctacaagccacaggcgcggccgccagcaacgtcgat
ttgtatcaaatcaactgcacctattacgatgccctcggccagaatgacttagattatttg
atggcgcgggcgattcagtttttcgcacccggtattccgcaggtgtattacgcgggtctg
ctggcgattccaaacgatatggatctgctcaacaacacccatgtcggtcgcgatatcaat
cgcccttacttgaaccgtgaaaaagtgcagcaagccatgcagaaacctgtcgttaaggcg
ctgactaaactgattaaactgcgtaatagcagcccagccttcgatggccgctttacgatg
gcatcagcagaacgcacgttaaccttatcttggacagcggccgattcgcaggcaagtctc
accctcgactttgccaataaagatggccaaatcatccttttagataagcaaggtaaagag
acacaagtgtcgttatcaaaactgttggctcaagcataa

DBGET integrated database retrieval system