KEGG   Shewanella baltica OS185: Shew185_0135Help
Entry
Shew185_0135      CDS       T00571                                 

Definition
oligopeptidase B
Orthology
K01354  
oligopeptidase B [EC:3.4.21.83]
Organism
sbm  Shewanella baltica OS185
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
161229..163364
Genome map
AA seq 711 aa AA seqDB search
MRSLLLTLGIAMLLSGCSTSKGQVPAPVAEKIPHVMTLHGVTRTDDYYWLRDDERKDPKV
LAHLEAENRYTAAYFKPLKPLQDGLFKELTERLVADESSVPYQWHQHSYYSRYKEGGEYP
LISRKGADGVEQVMLDVNERAKGHEFYGLGGASVSPDETMLAFGEDVLSRRVYHIYFKDL
ASGDMIVDVLENTEGRVVWANDNKHVFYIAKDLQTLLGYQVYRHELGTKQSSDVLVYEEQ
DDSFYISLGKTLDESQVVLFQESTTTSEVSVLDASEPLSLFKPVLAREEGHEYSVSKLGD
TYYILTNWQATNFRLMKVAIKDAADKSKWQEVVAHNPNARIEDELVLKDYLIIQTRENGL
TRIKVMPFNGQKPFELSFDEPAYVMGLDVNAQQDSNKLRIFYSSLTTPEAVYEYSLVNPD
RRDLLKQDQVLGGFDASQYRAERVFITARDGVKVPVSLVYRKDKFNKDGTNPLYQYGYGS
YGYTVEPDFSSSVISLLDRGFVYAIAHVRGSEMLGRPWYDDGKLLNKQNTFNDFIDVTTA
LTAQGYGDKNKVVASGGSAGGLLMGAIANQAPDKYFAIAAHVPFVDVVTTMLDESIPLTT
NEYDEWGNPNEKTYFDYMLSYSPYDNVTEQEYPHMLVTTGLHDSQVQYFEPAKWVAKLRD
VKNQWYKLDDKVLLLNVDMEAGHGGKSGRYRQYQDTAQEYAFFLSLLGMAK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcgatctctgctgctaactttaggtattgccatgttgttatccggttgttcgacctca
aaagggcaagtacccgccccagttgctgaaaaaattccccatgtgatgactttgcatggc
gtaacgcgcaccgatgattactattggctgcgtgacgatgaacgcaaagatcctaaagtg
ttggcccatctcgaagccgagaatcgctacactgcggcctatttcaaacccttaaagccg
ctgcaagatggcctttttaaagagttaactgagcgcttagtcgccgatgagtcgagcgtg
ccataccaatggcaccagcacagttattacagtcgttataaagaaggcggcgagtatccg
ctaatcagccgtaagggcgccgatggcgttgagcaagtgatgctggatgtgaatgagcga
gctaagggccatgagttttatggcttaggcggcgccagtgttagcccagatgaaaccatg
ttggcctttggtgaagacgtcctcagccgccgtgtgtaccacatctattttaaagacttg
gcctcgggcgacatgatcgtcgacgtgcttgaaaacaccgaaggtcgagtggtgtgggcg
aacgacaacaaacatgtgttctatatcgccaaagatttgcagaccttacttggctaccaa
gtgtatcgccatgagctggggactaagcaatcgagcgacgtgttagtgtatgaagaacaa
gacgattctttctatatctcgctcggcaaaaccttagatgagtcgcaagttgtgttgttc
caagagagcaccacgacgagcgaagtgtcagtgctcgatgccagcgaacctctgagttta
ttcaagccagtgttagcgcgggaagaaggccacgaatacagcgtgtctaagttgggcgat
acttattacattctcaccaactggcaggcgactaacttccgtttgatgaaagttgccatc
aaagatgcggcggacaaatctaagtggcaagaagtggttgcgcataaccccaatgcccgt
attgaagacgagttagtactcaaggattatctgattattcagacccgcgaaaacggcctg
acgcgaattaaagtgatgccgttcaatggtcaaaagcctttcgaactgagctttgatgaa
cctgcctatgtgatgggtttagatgttaatgcccagcaagacagcaataagttacgcatt
ttctactccagcctgacaacgccagaagccgtatacgaatattcgctagtgaatcccgat
agacgggatttattaaaacaagatcaagtcttaggcggcttcgatgccagccaatatcgt
gccgagcgtgtatttattacagctcgtgatggtgtgaaagtgcccgtttctttggtgtat
cgtaaagataaattcaacaaagatggcactaaccctctgtatcaatacggttatggatct
tacggttacacagttgaacccgatttttcttcatccgtaatcagtctgctcgatcgcggt
tttgtgtacgccatcgcccatgtacgcggctctgaaatgcttggtcgcccttggtatgac
gacggtaagctgttgaataagcaaaacaccttcaatgattttatcgacgtaacaacggca
ttaacggcacaaggttatggcgataaaaacaaggtcgtcgcctctggcggcagcgcgggc
ggtttgctaatgggcgcaattgctaaccaagcgccggacaagtactttgccatcgccgcc
catgtgccgtttgttgatgtggtgaccactatgctggacgagtcgattccgttgacgacc
aatgagtacgacgagtggggcaacccgaacgagaaaacctatttcgattacatgctgagt
tactcgccctacgacaatgttaccgagcaagaatacccacacatgttagtgacgacaggt
ttgcatgactcgcaagtgcagtattttgaacccgccaagtgggtcgctaagctgcgcgat
gttaaaaatcaatggtataagctcgacgataaagtcttattacttaacgtggatatggaa
gccggccacggtggtaagagtggtcgctatcgccagtatcaagacacagcccaagaatat
gcgttcttcttgagtctgttaggtatggcaaagtag

DBGET integrated database retrieval system