KEGG   Shewanella baltica OS185: Shew185_0371Help
Entry
Shew185_0371      CDS       T00571                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
sbm  Shewanella baltica OS185
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sbm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(415261..415911)
Genome map
AA seq 216 aa AA seqDB search
MALSEAAVKVQAALLERGLETPMLPSVYSSEERKDKIEHHMKEILTLMSLDLSDDSLADT
PRRIAKMYVDEIFSGLDYANFPKITVIDNKMGFDEMVRVQDISLTSTCEHHLVTIDGTAT
IAYLPRKKIIGLSKINRIVRFFAQRPQVQERLTQQVLVALQTLLETKDVAVKMDAVHYCV
KSRGVMDSTSSTTTTALGGIFKSNPATRAEFLHQSK
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcattaagtgaagcagcagtaaaagtacaagccgcgttattagaacgtggacttgaa
accccaatgctcccaagcgtttacagcagtgaagaacgtaaagacaagattgaacatcat
atgaaagaaatcctgacattaatgtcattggatctgtcagacgatagccttgccgatacg
ccgcgccgcattgctaaaatgtatgtcgatgaaatcttctccggcttagattatgcgaac
ttccctaagatcacggttatcgacaataagatgggcttcgatgaaatggtgcgagtgcaa
gacattagcctcaccagcacctgcgaacaccatttagtgacgatcgatggtactgcgacc
atagcttatctaccacgcaaaaaaatcatcggtttatcaaagattaatcgcatcgtgcgt
ttctttgcccaacgtccacaagtgcaagagcgtttgactcagcaagtgttagtcgcgctg
cagaccttgctcgaaaccaaagacgttgcggttaaaatggatgctgtgcattactgcgtc
aaatcccgtggcgtgatggactcaaccagttcgaccactaccacagcgctgggcggtatt
ttcaaatctaaccctgcgacccgcgccgagtttttgcatcagtctaaataa

DBGET integrated database retrieval system