KEGG   Shewanella baltica OS185: Shew185_0664Help
Entry
Shew185_0664      CDS       T00571                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
sbm  Shewanella baltica OS185
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shew185_0664
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Shew185_0664
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Shew185_0664
Enzymes [BR:sbm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Shew185_0664
Exosome [BR:sbm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Shew185_0664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
806261..807757
Genome map
AA seq 498 aa AA seqDB search
MNIKRIAAAISCSLMTVVAHAAVLPATQTDSQWFKDSAANVVAKAQVDTKKTAKNVILFV
GDGMSISTLTAARILQGQDKADNQGGEENFLSFEQFPHTALVKTYNTNQQTPDSAGTMTA
MATGVKTKAGIISISDTSLRGNCLSSKGNELVSLVDLANAKGLSTGIVTTARLTHATPAA
TYAKTPERDWEGDFNLPAEAVANGCTDIASQLVMRDEANSLTVALGGGRSYFLPTTVKDG
ENKAGKRKDGKDLTKAWVDNFSKSAYVWDKKGFDAIDAANTDHLLGLFNPSHMEYEADRA
DDVGGEPSLTEMTAKSLDILKKNDKGYLLIVESGRIDHGHHAGNASRALTDAVELSNAVK
AAMDATSSDDTLIMVTADHSHVFTIAGYPKRGNPILGLVHNVDGTLATANDNKPYTTLAY
TNGPGAVVGVRDDLTSVDTQDKDFMQQALIPMESETHAGEDISLHARGPGSNLVQGVIEQ
NVIFHIINQAQQLGGTKY
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaacggatcgctgcagctatctcctgcagcttaatgacggttgtagcccat
gctgcagtcctgccagcaacacaaacagacagccagtggtttaaagacagtgcggcaaac
gtggtggctaaagcccaagtcgacactaaaaaaaccgctaaaaatgtgattttatttgtc
ggtgacggcatgagtatttcgacgctaacggcagcccgtattctgcaagggcaggataaa
gctgacaaccaaggcggcgaagaaaacttcttaagtttcgaacagttcccccacacggcg
ttagtgaaaacctataacactaaccaacaaacgccagattctgcgggcactatgacagcc
atggcgacaggcgttaaaaccaaggcgggtattatctctatttcagataccagcttacgt
ggtaactgtttgtcttcaaaaggcaatgaacttgtctctctggtcgaccttgctaatgcc
aaaggattatcaacaggcatagtcactacggcgcgtttaacccacgccacgccagcggca
acctatgccaaaacccctgagcgcgattgggaaggcgatttcaacttacctgccgaagcg
gttgcgaacggttgtaccgacatcgcaagccaattggtaatgcgcgatgaagctaattcg
ttaactgtggcattaggtggtggccgtagctacttcctacctacaacagtgaaagatggc
gagaacaaagccggtaaacgtaaagacggcaaagacttaaccaaagcttgggtcgataat
ttcagcaaatctgcttacgtgtgggacaaaaaaggcttcgacgccattgatgctgccaac
acagatcatttactcggcctatttaatccatcacacatggaatacgaagcagaccgcgcc
gatgacgtaggtggtgagccatcactaactgaaatgaccgctaaatccctcgatattttg
aagaagaacgacaaaggctacttgctgatcgttgaatctggccgtatcgaccatggtcac
catgcgggcaatgcgagccgcgcgttgaccgatgcggttgaattatctaatgcagtcaaa
gcggcaatggatgcaacgagcagcgacgatactttgatcatggtaacagcggatcacagc
catgtgttcactatcgcaggctacccaaaacgcggtaaccctatcttaggtttagtgcat
aacgtcgatggcacgttagcgacggcgaatgacaacaagccttacaccacgctggcttat
accaacggcccaggtgctgtggtgggtgtgcgtgacgacttaacctcagttgatacgcaa
gataaagattttatgcaacaagcgcttatcccaatggaaagtgagactcacgccggtgaa
gacatcagcttacatgccagaggtccaggttcgaatctggttcagggcgtgattgagcag
aacgtgatcttccacattatcaaccaagcgcagcagcttggcggcactaagtactaa

DBGET integrated database retrieval system