KEGG   Shewanella baltica OS185: Shew185_1041Help
Entry
Shew185_1041      CDS       T00571                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
sbm  Shewanella baltica OS185
Pathway
sbm00670  One carbon pool by folate
sbm00790  Folate biosynthesis
sbm01100  Metabolic pathways
Module
sbm_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Shew185_1041
   00670 One carbon pool by folate
    Shew185_1041
Enzymes [BR:sbm01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Shew185_1041
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 YabP
Motif
Other DBs
NCBI-ProteinID: ABS07193
JGI: Shew1851041
Position
1236420..1236902
Genome map
AA seq 160 aa AA seqDB search
MRIAMIAAMSNNRVIGKENKMPWHLPEDLRHFKAMTLGKPVLMGRKTFESIGRPLPGRHN
IVISRQTDLVIEGVTCVTSFDAAKQAAGECEELVVIGGGQLYAELLPYADTLYLTQIKLE
VEGDTFFPHWDDGTWKETESLSSINADGLEYRFINLVKKC
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgcgcattgctatgatagccgcgatgtcaaacaatcgagtcatcggaaaagagaataaa
atgccatggcatcttccagaagatctacgtcactttaaagccatgaccctaggtaagcct
gtgctgatggggcgtaagacctttgagtccattggtagaccccttcctggtcgacataac
atagtgatttcacgtcaaacggatctcgtcattgaaggcgtgacctgtgtgacctctttt
gatgcagccaaacaagccgctggcgagtgtgaagagttagtggtgattggtggcggtcag
ctttatgccgagttattaccttacgcagataccttatatttgacgcaaatcaagctagag
gttgagggcgatacatttttcccccattgggatgacggaacttggaaagaaacggaatct
ttgtctagtataaatgcggatggtttggaatatcgctttatcaatttggtaaaaaaatgt
taa

DBGET integrated database retrieval system